HomeMy WebLinkAboutCity Council - 05/07/2024
AGENDA
CITY COUNCIL WORKSHOP & OPEN PODIUM
TUESDAY, MAY 07, 2024 CITY CENTER
5:00 – 6:25 PM, HERITAGE ROOMS
6:30 – 7:00 PM, COUNCIL CHAMBER
CITY COUNCIL: Mayor Ron Case, Council Members Kathy Nelson, Mark Freiberg, PG
Narayanan, and Lisa Toomey
CITY STAFF: City Manager Rick Getschow, Police Chief Matt Sackett, Fire Chief Scott Gerber,
Public Works Director Robert Ellis, Community Development Director Julie Klima, Parks and
Recreation Director Amy Markle, Administrative Services/HR Director Alecia Rose,
Communications Manager Joyce Lorenz, City Attorney Maggie Neuville, and Recorder Sara
Aschenbeck
Workshop - Heritage Rooms I and II (5:30)
I. 2023 AUDIT REPORT AND FINANCIAL STATEMENTS
II. FINANCIAL POLICIES
Open Podium - Council Chamber (6:30)
III. OPEN PODIUM
IV. ADJOURNMENT
AGENDA EDEN PRAIRIE CITY COUNCIL MEETING
TUESDAY, MAY 07, 2024 7:00 PM, CITY CENTER Council Chamber 8080 Mitchell Road
CITY COUNCIL: Mayor Ron Case, Council Members Kathy Nelson, Mark Freiberg, PG Narayanan, and Lisa Toomey CITY STAFF: City Manager Rick Getschow, Public Works Director Robert Ellis, Community
Development Director Julie Klima, Parks and Recreation Director Amy Markle, and City Attorney Maggie Neuville
I. CALL THE MEETING TO ORDER
II. PLEDGE OF ALLEGIANCE
III. OPEN PODIUM INVITATION
IV. PROCLAMATIONS AND PRESENTATIONS
A. HERITAGE PRESERVATION AWARD
B. 2023 ANNUAL COMPREHENSIVE FINANCIAL REPORT
C. SENIOR AWARENESS MONTH PROCLAMATION
V. APPROVAL OF AGENDA AND OTHER ITEMS OF BUSINESS
VI. MINUTES
A. COUNCIL WORKSHOP HELD TUESDAY, APRIL 16, 2024
B. CITY COUNCIL MEETING HELD TUESDAY, APRIL 16, 2024
VII. REPORTS OF ADVISORY BOARDS AND COMMISSIONS
VIII. CONSENT CALENDAR
A. CLERK’S LIST
B. EDEN PRAIRIE RIDGE BY THE PEMTOM LAND COMPANY APPROVE SECOND READING OF ORDINANCE FOR ZONING CHANGE ON 1.76
ACRES, APPROVE DEVELOPMENT AGREEMENT
C. ADOPT RESOLUTION APPROVING PARTICIPATION OF THE HENNEPIN COUNTY HOUSING AND REDEVELOPMENT AUTHORITY
IN EDEN PRAIRIE AFFORDABLE HOUSING PROJECTS
CITY COUNCIL AGENDA May 07, 2024
Page 2
D. ADOPT RESOLUTION APPROVING APPLICATION TO CONDUCT OFF-SITE GAMBLING BY EDEN PRAIRIE HOCKEY ASSOCIATION
E. ADOPT RESOLUTION APPROVING MEMBERSHIP IN HENNEPIN
COUNTY FIRE CHIEFS ASSOCIATION
F. ADOPT RESOLUTION ORDERING REMOVAL OF HAZARDOUS
BUILDING LOCATED AT 17391 RUSTIC HILLS DRIVE
G. ADOPT RESOLUTION APPROVING WEST 70TH STREET
CONDEMNATION SETTLEMENT AGREEMENT
H. ADOPT RESOLUTION ORDERING PETITIONED IMPROVEMENTS AND INCLUDE IN DELL ROAD IMPROVEMENT PLANS AND SPECIFICATIONS
I. APPROVE PROFESSIONAL SERVICES AGREEMENT FOR WEST 70TH
STREET IMPROVEMENT PROJECT CONSTRUCTION ADMINISTRATION WITH SRF CONSULTING GROUP
J. APPROVE PROFESSIONAL SERVICES AGREEMENT FOR PRAIRIE CENTER DRIVE PAVEMENT REHABILITATION PROJECT CONSTRUCTION ADMINISTRATION WITH SRF CONSULTING GROUP
K. APPROVE PROFESSIONAL SERVICES AGREEMENT FOR ANDERSON LAKES PHASE XI POND INVENTORY AND INSPECTION PROGRAM WITH STANTEC
L. APPROVE MODEL USE AGREEMENT WITH RILEY PURGATORY BLUFF CREEK WATERSHED DISTRICT
M. APPROVE INSTITUTION COMMUNITY WORK CREW AGREEMENT FOR 2024 THROUGH 2026
N. APPROVE PURCHASE OF KNOX BOX KEY SECURE DEVICES FROM KNOX COMPANIES
O. ACCEPT QUOTE AND AUTHORIZE ENTERING INTO CONTRACT FOR GOODS AND SERVICES FOR HIDDEN PONDS TRAIL TREE PLANTING WITH HOFFMAN & MCNAMARA
P. AWARD CONTRACT FOR REMOVAL AND REPLACEMENT OF CURB AND GUTTER TO CURB MASTERS INCORPORATED
IX. PUBLIC HEARINGS AND MEETINGS
A. ENCLAVE AT MANOR ROAD by Brandl Anderson. Resolution for Planned Unit Development (PUD) Concept Review, first reading of Ordinance for PUD District Review with Waivers and Zoning Change from Rural to R1-9.5 on 6.43
CITY COUNCIL AGENDA May 07, 2024
Page 3
acres, Resolution for Preliminary Plat on 6.43 acres, Resolution supporting Park Dedication Fees.
B. LOTUS VILLAS ON ANDERSON LAKE by Ron Clark Construction. Resolution for Guide Plan Change from Office to Low Density Residential on 5.0 acres, Resolution for PUD Concept Review, First reading of Ordinance for Zoning change from Office to R1-9.5 and PUD District Review with Waivers on 5 acres,
Resolution for Preliminary Plat on 5.0 acres, Resolution supporting Park Dedication Fees.
C. ASIA MALL PARKING LOT EXPANSION by Elliott Design Build, LLC.
Resolution for Planned Unit Development Concept Review on 4.69 acres, first reading of Ordinance for Planned Unit Development Review with Waivers on 4.69 acres.
X. PAYMENT OF CLAIMS
XI. ORDINANCES AND RESOLUTIONS
XII. PETITIONS, REQUESTS, AND COMMUNICATIONS
XIII. APPOINTMENTS
XIV. REPORTS
A. REPORTS OF COUNCIL MEMBERS
B. REPORT OF CITY MANAGER
C. REPORT OF COMMUNITY DEVELOPMENT DIRECTOR
D. REPORT OF PARKS AND RECREATION DIRECTOR
E. REPORT OF PUBLIC WORKS DIRECTOR
F. REPORT OF POLICE CHIEF
G. REPORT OF FIRE CHIEF
H. REPORT OF CITY ATTORNEY
XV. OTHER BUSINESS
XVI. ADJOURNMENT
Synopsis Heritage Preservation Commission Chair, Steve Schumacher, will introduce the Heritage Preservation
Awards. The award recognizes an individual, a family or a business who has made an outstanding contribution to Eden Prairie’s historic resources. The Mayor will present the awards. There are three recipients of the 2024 Heritage Preservation Award. Marcia Kolb and Johnny Severson, John Gertz, and Alexandra (Sasha) Allen will all be in attendance to receive their award. Background Marcia Kolb and Johnny Severson own a home on the north shore of Mitchell Lake. The 1.5-acre property is the old Moran farmstead and the home was built in 1870. Over the past decade, Marcia and Johnny have
been meticulously preserving and revitalizing the home and property. They have installed a basement, replaced missing trim with reclaimed age-appropriate woodwork, installed new windows, installed a roof, added new mechanical equipment, integrated modern amenities to enhance livability, and enhanced the lakeshore by reintroducing native plant species. All the renovation efforts were done to seamlessly blend with the home’s historical character. Their restoration project is a testament to Marcia and Johnny’s
commitment to preserving Eden Prairie’s local heritage. They have transformed a neglected piece of history into a cherished community treasure. They are preserving the home and property for generations to come. Marcia and Johnny kindly provide tours for those that are interested in seeing the home. John Gertz has been an advocate for the preservation of Eden Prairie’s historic resources for over 30 years.
For many years, he worked for the City of Eden Prairie as the Historic Resource Specialist. During his tenure with the City, John managed a large project to identify and survey the cultural resources of Eden Prairie in the early 1990’s. The surveys of these properties are still used today. In partnership with the Historical Society, he worked on projects and programs that brought awareness to the City’s historic resources. He also worked to get many historic properties locally designated as Heritage Preservation
Sites. With John’s extensive knowledge of the historic resources in Eden Prairie, he has been a trusted resource for the Historical Society over the years. Although John does not live in Eden Prairie, he has strong ties to the community and has provided advice on a variety of history related projects in Eden Prairie. In 2017, John worked with Paul Thorp on researching and identifying the Yorkville and Bloomington Road. John’s many contributions to the history of Eden Prairie can be seen throughout the
community.
CITY COUNCIL AGENDA
SECTION: Proclamations and Presentations
DATE
May 7, 2024
DEPARTMENT / DIVISION:
Community
Development/Planning
Julie Klima/Beth Novak-Krebs
ITEM DESCRIPTION
Heritage Preservation Awards
ITEM NO.
IV.A.
Alexandra (Sasha) Allen is a Senior at Eden Prairie High School, a student member of the Heritage Preservation Commission (HPC) and is the president of the History Club at her high school. She has been
interested in historical research and storytelling since she was in 6th grade. She is being recognized for her
documentaries and storytelling about historical topics. One of Sasha’s recent documentaries is about an unsung hero that lived right here in Eden Prairie. The name of the documentary is 3-6-9 Kid: How Child Spy Agnes Lackovic Saved Hundreds from the Nazis. The story is about a teenage WW II spy in Germany whose clever spy work led to hundreds of lives saved from Nazi persecution. Her name was Agnes
Lackovic. After WW II she married a GI and moved to Eden Prairie. Her married name was Agnes
Daluge. Sasha masterfully brings to light the story about a person that lived here in Eden Prairie and deserves recognition. The history of Eden Prairie is not just about buildings and places, but also about the people that live here.
Heritage Preservation Commission members are:
• Steve Schumacher, Chair
• Paul Thorp, Vice Chair
• Rod Fisher,
• George Maxwell
• Cathy Lau
• Robert Bowes
• Andy Ludowese
• Beth Novak-Krebs, Staff Liaison
CITY COUNCIL AGENDA
SECTION: Proclamations and Presentations
DATE:
May 7, 2024
DEPARTMENT/DIVISION:
Tammy Wilson, Office of the City Manager/Finance
ITEM DESCRIPTION:
2023 Annual Comprehensive Financial Report (ACFR)
ITEM NO.:
IV.B.
Requested Action
Move to: Accept the 2023 Annual Comprehensive Financial Report (ACFR). Synopsis
Minnesota statutes require that the City prepare an annual financial report and statements in accordance with Generally Accepted Accounting Principles. The attached reports meets these requirements.
The report was prepared by the Finance Division and audited by the independent auditing firm of
BerganKDV. BerganKDV issued an unmodified opinion which is the highest level of opinion the City can receive and means the auditor believes the financial statements are fairly presented in all material respects.
Caroline Stutsman, Partner for the accounting firm will make a presentation of the financial report.
Attachments 2023 ACFR
2023 Internal Control Letter 2023 Communications Letter
CITY OF EDEN PRAIRIE, MINNESOTA
ANNUAL COMPREHENSIVE FINANCIAL REPORT
For the Fiscal Year Ended December 31, 2023
This page is intentionally left blank
2
ANNUAL COMPREHENSIVE FINANCIAL REPORT of the CITY OF EDEN PRAIRIE MINNESOTA For The Fiscal Year Ended December 31, 2023 Rick Getschow, City Manager Prepared by THE FINANCE DIVISION Tammy Wilson, Chief Financial Officer
3
City of Eden Prairie, Minnesota For the Year Ended December 31, 2023 Table of Contents Page Introductory Section Letter of Transmittal ....................................................................................................................................................... 8 GFOA Certificate of Achievement ........................................................................................................................... 15 Organizational Chart .................................................................................................................................................... 16 List of Principal Officials ............................................................................................................................................. 17 Financial Section Independent Auditors’ Report ................................................................................................................................. 20 Management’s Discussion and Analysis .............................................................................................................. 24 Basic Financial Statements Government-wide Financial Statements Statement of Net Position ............................................................................................................................... 38 Statement of Activities ..................................................................................................................................... 40 Fund Financial Statements Balance Sheet-Governmental Funds .......................................................................................................... 44 Reconciliation of the Balance Sheet of Governmental Funds to the Statement of Net Position ............................................................................................................. 45 Statement of Revenues, Expenditures and Changes in Fund Balances – Governmental Funds ................................................................................................ 46 Reconciliation of the Statement of Revenues, Expenditures and Changes in Fund Balances of Governmental Funds to the Statement of Activities .................................. 47 Statement of Revenues, Expenditures and Changes in Fund Balance – Budget and Actual – General Fund ....................................................................... 49 Statement of Net Position – Proprietary Funds .................................................................................... 52 Statement of Revenues, Expenses and Changes in Net Position – Proprietary Funds ......... 53 Statement of Cash Flows – Proprietary Funds ....................................................................................... 54 Statement of Fiduciary Net Position ......................................................................................................... 56 Statement of Changes in Fiduciary Net Position ................................................................................... 57 Notes to Financial Statements ............................................................................................................................ 60 Required Supplemental Information Modified Approach for Infrastructure Assets ......................................................................................... 104 Schedule of Changes in the City’s Total OBEB Liability and Related Ratios .............................. 105 Schedule of Proportionate Share of Net Pension Liability Public Employees General Employees Retirement Fund .................................................................. 106 Public Employees Police and Fire Fund .................................................................................................... 107 Eden Prairie Fire Relief .................................................................................................................................... 108 Schedule of Contributions Public Employees General Employees Retirement Fund .................................................................. 109 Public Employees Police and Fire Fund .................................................................................................... 110 Eden Prairie Fire Relief .................................................................................................................................... 111
4
City of Eden Prairie, Minnesota For the Year Ended December 31, 2023 Notes to Required Supplemental Information Notes to Schedule of Changes in Net Pension Liabilities and Related Ratios ........................... 112 Combining Fund Statements Combining Balance Sheet – Nonmajor Governmental Funds .......................................................... 127 Combining Statement of Revenues, Expenditures and Changes in Fund Balances – Nonmajor Governmental Funds ............................................................................. 136 Combining Statement of Net Position – Internal Service Funds ..................................................... 146 Combining Statement of Revenues, Expenses and Changes in Net Position – Internal Service Funds .................................................................................................... 148 Combining Statement of Cash Flows – Internal Service Funds ....................................................... 150 Combining Statement of Fiduciary Net Position .................................................................................. 155 Combining Statement of Changes in Fiduciary Net Position ............................................................ 156 Statistical Section Government-wide Net Position by Category ........................................................................................... 159 Changes in Net Position - Total ..................................................................................................................... 160 Changes in Net Position – Governmental Activities ............................................................................. 161 Changes in Net Position – Business-type Activities ............................................................................. 162 Fund Balances – Governmental Funds ....................................................................................................... 163 Changes in Fund Balances – Governmental Funds ............................................................................... 164 Assessed/Tax Capacity Value and Estimated Market Value of Property .................................... 165 Direct and Overlapping Property Tax Rates ............................................................................................ 166 Principal Property Taxpayers ........................................................................................................................ 167 Property Tax Levies and Collections .......................................................................................................... 168 Legal Debt Margin ............................................................................................................................................... 169 Ratios of Outstanding Debt by Type ........................................................................................................... 170 Ratios of General Bonded Debt Outstanding ........................................................................................... 171 Computation of Direct and Overlapping Bonded Debt ....................................................................... 172 Demographic and Economic Statistics ....................................................................................................... 173 Principal Employers ........................................................................................................................................... 174 Employees by Function .................................................................................................................................... 175 Operating Indicators .......................................................................................................................................... 176 Capital Assets Statistics by Function .......................................................................................................... 177
5
This page is intentionally left blank
6
INTRODUCTORY SECTION
7
April 22, 2024
To the Honorable Mayor, Members of the City Council and the Citizens of the City of
Eden Prairie:
The annual comprehensive financial report of the City of Eden Prairie, Minnesota, for the
year ended December 31, 2023, is hereby submitted. The report was prepared in
accordance with accounting principles generally accepted in the United States of America
(GAAP) as established by the Governmental Accounting Standards Board and meets the
requirements of the State Auditor’s Office.
The report consists of management’s representations concerning the finances of the City.
Consequently, management assumes full responsibility for the completeness and reliability
of all information presented within this report. To provide a reasonable basis for making
these representations, management of the City has established internal controls designed
to protect the City’s assets from loss, theft or misuse and to provide sufficient information
for the preparation of these financial statements in conformity with GAAP. Because the
cost of internal controls should not outweigh the benefits, the City’s internal controls have
been designed to provide reasonable rather than absolute assurance that the financial
statements will be free from material misstatements. As management, we assert that to the
best of our knowledge and belief this financial report is complete and reliable in all
material respects.
The City’s financial statements have been audited by BerganKDV, Ltd, Certified Public
Accountants. The goal of the independent audit was to provide reasonable assurance that
the financial statements of the City for the year ended December 31, 2023, are free of
material misstatement. The independent audit involved examining, on a test basis,
evidence supporting the amounts and disclosures in the financial statements, assessing the
accounting principles used and significant estimates used by management; and evaluating
the overall financial statement presentation. Based upon the audit, the independent
auditor concluded that there was reasonable basis for rendering an unmodified opinion
that the City’s financial statements, for the year ended December 31, 2023, are fairly
presented in conformity with GAAP. The independent auditors’ report is present in the
financial section of this report.
8
GAAP requires that management provide a narrative introduction, overview, and analysis
to accompany the basic financial statements in the form of Management’s Discussion and
Analysis (MD&A). This letter of transmittal is designed to complement the MD&A and
should be read in conjunction with it. The City’s MD&A can be found in the financial section
of this report immediately following the report of the independent auditors.
City Profile
Eden Prairie is a suburban community of 64,023 people located in the southwest corner of
Hennepin County in a setting of rolling hills and picturesque lakes and creeks. Eden Prairie
has a convenient location, a comprehensive system of highways, and is a short distance
from downtown Minneapolis and St. Paul and the Minneapolis-St. Paul International
Airport.
Incorporated in 1974 as a city, the City of Eden Prairie operates under a Statutory Plan B
form of government. Policymaking and legislative authorities are vested in the governing
council, which consists of a mayor and a four-member council. The governing council is
responsible, among other things, for passing ordinances, adopting the budget, appointing
committees and hiring the government's manager and attorney. The council is elected on a
nonpartisan basis. The mayor and council members are elected to four-year staggered
terms. The City Manager is responsible for carrying out the policies and ordinances of the
governing council, for overseeing the day-to-day operations of the government, and to
assign appropriate responsibility and authority to City staff for the efficient and effective
delivery of City services.
With a staff of around 285 regular, full-time equivalent employees, the City provides its
residents and businesses with a full range of municipal services consisting of police and fire
protection, street maintenance, recreation programs, park maintenance, community and
economic development, building inspections, and water, wastewater and storm water
services.
The City is also financially accountable for the Housing and Redevelopment Authority
(HRA), which is included in the City’s financial statements as a blended component unit.
Additional information on the HRA is located in Note 1 in the notes to the financial
statements.
The biennial budget serves as the foundation for the City’s financial planning and control.
Departments submit budget requests to Finance in May and the City Manager presents the
proposed budget to the City Council for review prior to September 30th of each year. A
budget workshop is usually held with the City Council in June or July. The City Council
holds a public meeting on the proposed budget and adopts the final budget in December
each year. The City does not budget for governmental funds other than the General fund.
9
During the first year of the two-year budget process, both years’ budgets are developed and
the City Council adopts the first year’s budget. During the second year of the two-year
budget process, budget work is minimized. Staff updates the budget for any significant
budget development,s and the council then reviews and adopts the second year budget.
The budget is prepared by department and division. The City’s directors and division
managers may make transfers of appropriations within a division. Transfers of
appropriations between departments require the approval of the City Manager. Any
changes in the total budget must be approved by the City Council.
Economic Conditions and Outlook
Eden Prairie is a suburban community located in the southwest corner of the
Minneapolis/St. Paul Metropolitan area. With the last update of the comprehensive plan
and the trend towards condensed multi-family housing along the LRT corridor and other
multi-family projects in other locations within the City, it is expected that Eden Prairie’s
population will grow to 82,400 by 2040 an increase of 29% from 2023.
Below summarizes the City’s market value since 2015.
The City’s tax base increased from $11.8 billion to $13.4 billion from 2022 to 2023. In
2024, the market value increased to $14.3 billion. The real estate market has seen
significant increases nationwide. Home prices have increased by the following approximate
percentages: Nationally-20%, Statewide-15%, Twin Cities Suburbs-18%. Eden Prairie’s
unemployment rate is 2.4%, which is less than the State rate of 2.8% and the Federal rate
of 3.6%.
10
We had another strong year in licenses and permits, and Inspections issued permits with a
value of $195,785,542. The largest project was The Golden Triangle Station apartment
with a value of $39,512,670. The City also had 4 new commercial/industrial buildings
versus 7 in 2022. The valuations of these new buildings ranged from $1,000,000 to
$9,400,000.
Eden Prairie serves as the corporate headquarters location for many national and
international businesses including United Health Group, CH Robinson World Wide, Tennant
Company, Optum, Lifetouch/ShutterFly, Starkey Hearing, MTS Corporation, Arctic Wolf,
and hundreds of other small and mid-size companies headquartered in multi-tenant office
buildings located throughout the City.
Eden Prairie also has key locations for retailing including the City’s mall which has
approximately 1.5 million square feet of shopping. The mall is part of the City’s “Major
Center Area” or downtown. Stores include a 160,000 square foot Von Maur Department
Store, Scheels, a Barnes and Noble Bookstore, an 18-screen AMC Movie Theater, and
numerous restaurants.
Due to its strong and healthy local economy, Moody’s Investors Service has assigned a
rating of Aaa to the City of Eden Prairie’s (MN) bond for every debt issue since 2003, the
highest rating from Moody’s. Standard & Poor’s has also assigned a rating of AAA to the
City of Eden Prairie’s bonds outstanding, their highest rating as well. This ensures the City
receives the most competitive interest rates. The City’s bond ratings reflect Eden Prairie’s
large, growing tax base, very healthy operating reserves, low direct debt burden, and
strong financial management.
Long‐term Financial Planning
The City has implemented various financial policies to guide the Council and staff when
making financial decisions. This helps to ensure the long-term stability and flexibility of
City finances and operations. These policies include the following:
The original budget should be balanced with revenues equal to expenditures,
One-time revenues will be used for one-time expenditures,
The City will maintain fund balance for working capital in the general fund at 50%
of the next year’s budgeted tax revenue,
The City will also maintain 10% of the next year’s budget in fund balance for budget
stabilization and 5% of the next year’s budget for budget balancing in the general
fund,
The City will confine long-term debt to capital improvements or projects that cannot
be financed from current revenues, and
11
The City will maintain a ten-year capital improvement plan to provide for capital
asset acquisition, maintenance, replacement, and retirement.
The City has consistently followed our financial policies.
Major Initiatives
Electrify Everything MN
The cities of Eden Prairie, Edina, and St. Louis Park are partnering on a residential
electrification campaign in 2023 called Electrify Everything MN to meet our respective
Climate Action Plan (CAP) goals around fuel switching. Eden Prairie’s CAP includes a goal
that 17% of households have switched from being served by natural gas for space and
water heating to electricity by 2030, 55% of households by 2040, and 97% of households
by 2050. Actions identified to encourage fuel switching include:
Promoting building efficiency to reduce up-front costs of electrification
Explore incentives to promote fuel switching
Parks, Recreation, and Natural Resources Guide Plan Update
The Guide Plan development has been a process and a vehicle to engage residents, elected
officials, and City staff in imagining and giving guidance to our future. Previous
master/comprehensive park plans were created in 1965, 1989 and 2003. Also, in 2018, Parks
and Recreation staff participated in the development of the City’s updated comprehensive plan,
Aspire Eden Prairie 2040, which has components that serve as a foundation and data source for
this Guide Plan update. The new Parks, Recreation, and Natural Resources Guide is intended to
recognize and embrace past efforts, acknowledge changes, integrate programming efforts, and
inform plans and efforts into the future.
Round Lake Park Building
The new Round Lake building was substantially completed and opened to the public in
2024. This state-of-the-art building features two meeting rooms, changing rooms and
restrooms that are accessible from both inside and outside of the building. Energy
conservation features include solar and geothermal energy, and a green roof. The building
costs of $3M were paid with funds from the Park Improvement and Capital Maintenance
Improvement funds.
Duck Lake Road Earns American Public works Association‐MN Structural Project of the Year
The Duck Lake Road Improvement Project transformed a key stretch of Duck Lake Road,
resulting in a safer and more environmentally friendly corridor. Construction was largely
12
completed in fall 2022 and there was a ceremonial ribbon-cutting event in June 2023. The
project included a fully reconstructed roadway from Duck Lake Trail to Mallard Court; a
new bridge and fishing pier; enhanced stormwater management features; new paved trail;
and concrete curb and gutter. The project was selected due to the many engineering
challenges that were overcome in order to successfully rebuild the road and bridge.
Electrification of Vehicle Fleet
During the year, the City purchased its second electric Zamboni, two electric police
vehicles, two electric utility vans, and an electric dump truck. The City also added
additional EV charging stations for the Police department.
Paravel Apartments
The Paravel Apartments opened in August 2023. The five and seven story buildings include
246 units. Of the 246 units, 62 are affordable units per the City’s Inclusionary Housing
policy.
Certificate of Achievement
The Government Finance Officers Association of the United States and Canada (GFOA)
awarded a Certificate of Achievement for Excellence in Financial Reporting to the City of
Eden Prairie for its Annual Comprehensive Financial Report for the fiscal year ended
December 31, 2022.
The Certificate of Achievement is a prestigious national award-recognizing conformance
with the highest standards for preparation of state and local government financial reports.
In order to be awarded a Certificate of Achievement, a government unit must publish an
easily readable and efficiently organized comprehensive annual financial report whose
contents conform to program standards. Such comprehensive annual financial report must
satisfy both generally accepted accounting principles and applicable legal requirements. A
Certificate of Achievement is valid for a period of one year. The City of Eden Prairie has
received a Certificate of Achievement every year since 1990. We believe our current report
continues to conform to the Certificate of Achievement program requirements, and we are
submitting it to GFOA.
In addition, the Government Finance Officers Association of the United States and Canada
(GFOA) presented the Distinguished Budget Presentation award to the City of Eden Prairie
for its Two Year Budget for the fiscal years beginning January 1, 2022 and 2023. In order
to receive this award, a government unit must publish a budget document that meets
program criteria as a policy document, as an operations guide, as a financial plan and a
communications device. The award is valid for a period of two years only. The City of Eden
13
Prairie has received a Distinguished Budget Presentation award for every budget since
1998.
Also, the Government Finance Officers Association of the United States and Canada (GFOA)
has given an Award for Outstanding Achievement in Popular Annual Financial Reporting to
the City of Eden Prairie for its Popular Annual Financial Report for the fiscal year ended
December 31, 2022. The Award for Outstanding Achievement in Popular Annual Financial
Reporting is a national award recognizing conformance with the highest standards for
preparation of state and local government financial reports. In order to receive an Award
for Outstanding Achievement in Popular Annual Financial Reporting, a government unit
must publish a Popular Annual Financial Report, whose contents conform to program
standards of creativity, presentation, understandability, and reader appeal. An Award for
Outstanding Achievement in Popular Annual Financial Reporting is valid for a period of one
year only. The City of Eden Prairie has received the award annually since 1998. We believe
our current report continues to conform to the Popular Annual Financial Reporting
requirements, and we are submitting it to GFOA.
Acknowledgements
We would like to thank the Mayor and Council Members for their continued support in
planning and conducting the financial operations of the City in a responsible and
progressive manner. We would also like to express our appreciation to the employees of
the Finance Division for their contribution to the preparation of this report.
Respectfully submitted,
Rick Getschow Tammy Wilson
City Manager Chief Financial Officer
14
Government Finance Officers Association
Certificate of
Achievement
for Excellence
in Financial
Reporting
Presented to
City of Eden Prairie
Minnesota
For its Annual ComprehensiveFinancial Report
For the Fiscal Year Ended
December 31, 2022
Executive Director/CEO
15
City of Eden Prairie, Minnesota For the Year Ended December 31, 2023
City Council
City Manager
Administration
Administrative Services
City Clerk
Facilities
Human Resources & Support Services
Information Technology
Communications Finance & Liquor Operations
Community Development
Assessing
Economic Development
Housing & Community Services
Planning
Public Works
Engineering
Fleet Services
Streets Maintenance
Utilities
Police
Investigations
Patrol
Support
Fire
Building Inspections
Fire Prevention
Fire Suppresion
Parks & Recreation
Community Center
Parks & Natural Resources
Recreation Services
16
City of Eden Prairie, Minnesota For the Year Ended December 31, 2023 Principal Officials Elected Officials: Mayor (Term expiration 12/31/26) Ron Case Council Member (Term expiration 12/31/26) Mark Freiberg Council Member (Term Expiration 12/31/24) PG Narayanan Council Member (Term expiration 12/31/26) Kathy Nelson Council Member (Term expiration 12/31/24) Lisa Toomey Appointed Officials: City Manager Rick Getschow City Attorney Maggie Neuville Departments: Chief of Police Matt Sackett Community Development Director Julie Klima Fire Chief Scott Gerber Parks and Recreation Director Amy Markle Public Works Director Robert Ellis
17
This page is intentionally left blank
18
FINANCIAL SECTION
19
Independent Auditor's Report
Honorable Mayor and Members
of the City Council
City of Eden Prairie
Eden Prairie, Minnesota
Report on the Audit of the Financial Statements
Opinions
We have audited the financial statements of the governmental activities, the business-type
activities, each major fund, and the aggregate remaining fund information of the City of Eden
Prairie, Minnesota, as of and for the year ended December 31, 2023, and the related notes to the
basic financial statements, which collectively comprise City's basic financial statements as listed in
the Table of Contents.
In our opinion, the accompanying financial statements present fairly, in all material respects, the
respective financial position of the governmental activities, the business-type activities, each major
fund, and the aggregate remaining fund information of the City of Eden Prairie, Minnesota, as of
December 31, 2023, and the respective changes in financial position and, where applicable, cash
flows thereof, and the budgetary comparison for the General Fund for the year then ended in
accordance with accounting principles generally accepted in the United States of America.
Basis for Opinions
We conducted our audit in accordance with auditing standards generally accepted in the United
States of America (GAAS) and the standards applicable to financial audits contained in Government
Auditing Standards, issued by the Comptroller General of the United States. Our responsibilities
under those standards are further described in the Auditor's Responsibilities for the Audit of the
Financial Statements section of our report. We are required to be independent of the City of Eden
Prairie and to meet our other ethical responsibilities, in accordance with the relevant ethical
requirements relating to our audit. We believe that the audit evidence we have obtained is sufficient
and appropriate to provide a basis for our audit opinions.
Emphasis of Matter – Implementation of GASB 96
The City has adopted new accounting guidance, Governmental Accounting Standards Board (GASB)
Statement No. 96, Subscription-Based Information Technology Arrangements. Our opinion is not
modified with respect to this matter.
Report on Summarized Comparative Information
We have previously audited the City's 2022 financial statements of the governmental activities, the
business-type activities, each major fund, and the aggregate remaining fund information, and we
expressed unmodified opinions on those financial statements in our report dated April 19, 2023. In
our opinion, the summarized comparative information presented herein as of and for the year ended
December 31, 2022, is consistent, in all material respects, with the audited financial statements
from which it has been derived.
20
Responsibilities of Management for the Financial Statements
The City of Eden Prairie's management is responsible for the preparation and fair presentation of the
financial statements in accordance with accounting principles generally accepted in the United
States of America, and for the design, implementation, and maintenance of internal control relevant
to the preparation and fair presentation of financial statements that are free from material
misstatement, whether due to fraud or error.
In preparing the financial statements, management is required to evaluate whether there are
conditions or events, considered in the aggregate, that raise substantial doubt about the City of Eden
Prairie's ability to continue as a going concern for twelve months beyond the financial statement
date, including any currently known information that may raise substantial doubt shortly thereafter.
Auditor's Responsibilities for the Audit of the Financial Statements
Our objectives are to obtain reasonable assurance about whether the financial statements as a whole
are free from material misstatement, whether due to fraud or error, and to issue an auditor's report
that includes our opinions. Reasonable assurance is a high level of assurance but is not absolute
assurance and therefore is not a guarantee that an audit conducted in accordance with GAAS and
Government Auditing Standards will always detect a material misstatement when it exists. The risk
of not detecting a material misstatement resulting from fraud is higher than for one resulting from
error, as fraud may involve collusion, forgery, intentional omissions, misrepresentations, or the
override of internal control. Misstatements are considered material if there is a substantial likelihood
that, individually or in the aggregate, they would influence the judgment made by a reasonable user
based on the financial statements.
In performing an audit in accordance with GAAS and Government Auditing Standards, we:
Exercise professional judgment and maintain professional skepticism throughout the audit. Identify and assess the risks of material misstatement of the financial statements, whether
due to fraud or error, and design and perform audit procedures responsive to those risks. Such
procedures include examining, on a test basis, evidence regarding the amounts and
disclosures in the financial statements. Obtain an understanding of internal control relevant to the audit in order to design audit
procedures that are appropriate in the circumstances, but not for the purpose of expressing
an opinion on the effectiveness of the City's internal control. Accordingly, no such opinion is
expressed. Evaluate the appropriateness of accounting policies used and the reasonableness of significant
accounting estimates made by management, as well as evaluate the overall presentation of
the financial statements.
Conclude whether, in our judgment, there are conditions or events, considered in the
aggregate, that raise substantial doubt about the City's ability to continue as a going concern
for a reasonable period of time.
We are required to communicate with those charged with governance regarding, among other
matters, the planned scope and timing of the audit, significant audit findings, and certain internal
control–related matters that we identified during the audit.
21
Required Supplementary Information
Accounting principles generally accepted in the United States of America require that the
Management's Discussion and Analysis, which follows this report letter, and Required Supplementary
information as listed in the Table of Contents be presented to supplement the basic financial
statements. Such information is the responsibility of management and, although not a part of the
basic financial statements, is required by the GASB, who considers it to be an essential part of
financial reporting for placing the basic financial statements in an appropriate operational,
economic, or historical context. We have applied certain limited procedures to the Required
Supplementary Information in accordance with auditing standards generally accepted in the United
States of America, which consisted of inquiries of management about the methods of preparing the
information and comparing the information for consistency with management's responses to our
inquiries, the basic financial statements, and other knowledge we obtained during our audit of the
basic financial statements. We do not express an opinion or provide any assurance on the information
because the limited procedures do not provide us with sufficient evidence to express an opinion or
provide any assurance.
Supplementary Information
Our audit was conducted for the purpose of forming opinions on the financial statements that
collectively comprise the City of Eden Prairie's basic financial statements. The accompanying
supplementary information identified in the Table of Contents is presented for purposes of additional
analysis and are not a required part of the basic financial statements.
Such information is the responsibility of management and was derived from and relates directly to
the underlying accounting and other records used to prepare the basic financial statements. The
information has been subjected to the auditing procedures applied in the audit of the basic financial
statements and certain additional procedures, including comparing and reconciling such information
directly to the underlying accounting and other records used to prepare the basic financial
statements or to the basic financial statements themselves, and other additional procedures in
accordance with auditing standards generally accepted in the United States of America. In our
opinion, the accompanying supplementary information is fairly stated, in all material respects, in
relation to the basic financial statements as a whole.
Other Information
Management is responsible for the other information included in the Annual Comprehensive Financial
Report. The other information comprises the introductory and statistical sections but does not
include the basic financial statements and our auditor's report thereon. Our opinions on the basic
financial statements do not cover the other information, and we do not express an opinion or any
form of assurance thereon.
In connection with our audit of the basic financial statements, our responsibility is to read the other
information and consider whether a material inconsistency exists between the other information and
the basic financial statements, or the other information otherwise appears to be materially
misstated. If, based on the work performed, we conclude that an uncorrected material misstatement
of the other information exists, we are required to describe it in our report.
22
Other Reporting Required by Government Auditing Standards
In accordance with Government Auditing Standards, we have also issued our report dated April 22,
2024, on our consideration of the City of Eden Prairie's internal control over financial reporting and
on our tests of its compliance with certain provisions of laws, regulations, contracts, and grant
agreements and other matters. The purpose of that report is solely to describe the scope of our
testing of internal control over financial reporting and compliance and the results of that testing,
and not to provide an opinion on the effectiveness of internal control over financial reporting or on
compliance. That report is an integral part of an audit performed in accordance with Government
Auditing Standards in considering the City of Eden Prairie's internal control over financial reporting
and compliance.
St. Cloud, Minnesota
April 22, 2024
23
City of Eden Prairie, Minnesota Management’s Discussion and Analysis As management of the City of Eden Prairie, this section of the City’s comprehensive annual financial report presents a discussion and analysis of the City’s financial activities during the fiscal year ended December 31, 2023. This discussion and analysis should be read in conjunction with the transmittal letter in the introductory section of this report. Financial Highlights
The City as a Whole
• The assets and deferred outflow of resources of the City exceeded liabilities and deferred inflows of resources by $448,594,793. Of this amount, $108,142,993 (unrestricted net position) may be used to meet the City’s ongoing obligations to citizens and creditors, $322,468,804 is invested in capital assets, and $17,982,996 is restricted.
• The City’s total net position increased by $11,544,397 or 2.6%. The key factors in this increase were positive General Fund results and increased Parks and Recreation program revenue. Another contributing factor was the increase in investment income. The City was able to transfer positive General Fund results to the Capital Improvement and Maintenance Fund as one-time revenue to support the Capital Improvement Plan.
• The City had a prior period adjustment of $4,469,649 due to a change in accounting policy related to capitalized assets in aggregate. Assets in aggregate over $50,000 are now capitalized.
• The City’s total long-term liabilities decreased by ($27,752,573) or (31.1%) in comparison with the prior year. Contributing to the overall decrease was a decrease in the net pension liability of ($24.7M) and Other Post Employment Benefits Liability of ($514k). Additionally, there was a decrease in bonds payable of ($3.3M) for the current year retirement of debt. These decreases were offset by an increase in IT subscriptions of $842k. GASB Statement No. 96 was implemented in 2023 with the recognition of long-term subscription-based technology arrangements and their related principal payments. These subscriptions are for payroll and time keeping, fleet maintenance, police body cameras, emergency citizen alerts, email and City website hosting. Using This Annual Report This annual report consists of a series of financial statements. The Statement of Net Position and the Statement of Activities provide information about the activities of the City as a whole and present a longer-term view of the City’s finances. For governmental activities, the fund financial statements tell how these services were financed in the short term as well as what remains for future spending. Fund financial statements also report the City’s operations in more detail than the government-wide statements by providing information about the City’s most significant funds. The remaining statements provide financial information about activities for which the City acts solely as a trustee or agent for the benefit of those outside of the government.
24
City of Eden Prairie, Minnesota Management’s Discussion and Analysis
Reporting the City as a Whole
The Statement of Net Position and the Statement of Activities One of the most important questions asked about the City’s finances is “Is the City as a whole better off or worse off as a result of the year’s activities?” The Statement of Net Position and the Statement of Activities report information about the City as a whole and about its activities in a way that helps answer this question. These statements include all assets, deferred outflows of resources, liabilities and deferred inflows of resources using the accrual basis of accounting, which is similar to the accounting used by most private-sector companies. All of the current year’s revenues and expenses are taken into account regardless of when cash is received or paid. These two statements report the City’s net position and changes in them. You can think of the City’s net position – the difference between assets, deferred outflows of resources, liabilities, and deferred inflows of resources – as one way to measure the City’s financial health, or financial position. Over time, increases or decreases in the City’s net position is one indicator of whether its financial health is improving or deteriorating. You will need to consider other nonfinancial factors, however, such as changes in the City’s property tax base and the condition of the City’s roads, to assess the overall health of the City. In the Statement of Net Position and the Statement of Activities, we divide the City into two kinds of activities:
• Governmental Activities – Most of the City’s basic services are reported here, including general government, public safety, public works, and parks and recreation. Property taxes, charges for services, and capital grants and contributions finance most of these activities.
• Business-type Activities – The City charges a fee to customers to help it cover all or most of the cost of certain services it provides. The City’s utility system (Water, Wastewater and Stormwater Funds) and liquor operations are reported here.
Reporting the City’s Most Significant Funds Fund Financial Statements The fund financial statements provide detailed information about the most significant funds – not the City as a whole. Some funds are required to be established by State law and by bond covenants. However, the City Council establishes many other funds to help it control and manage money for particular purposes or to show that it is meeting legal responsibilities for using certain grants and other money. The City’s two kinds of funds – governmental and proprietary – use different accounting approaches.
• Governmental funds – Most of the City’s basic services are reported in governmental funds, which focus on how money flows into and out of those funds and the balances left at year-end that are available for spending. These funds are reported using an accounting method called modified accrual accounting, which measures cash and all other financial assets that can
25
City of Eden Prairie, Minnesota Management’s Discussion and Analysis readily be converted to cash. The governmental fund statements provide a detailed short-term view of the City’s general government operations and the basic services it provides. Governmental fund information helps to determine whether there are more or fewer financial resources that can be spent in the near future to finance the City’s programs. We describe the relationship between governmental activities (reported in the Statement of Net Position and the Statement of Activities) and governmental funds in a reconciliation provided after the fund financial statements.
• Proprietary funds – When the City charges customers for the services it provides – these services are generally reported in proprietary funds. Proprietary funds are reported in the same way that all activities are reported in the Statement of Net Position and the Statement of Activities. The City of Eden Prairie maintains two different types of proprietary funds.
• Enterprise funds are the same as the business-type activities reported in the government-wide statements but provide more detail and additional information, such as cash flows.
• Internal service funds are an accounting device used to accumulate and allocate costs internally among the City’s various functions. The City uses internal service funds to account for activities pertaining to employee benefits, workers compensation, personal time off accruals, property insurance, facilities, fleet services, and information technology.
The City as Trustee Reporting the City’s Fiduciary Responsibilities All of the City’s fiduciary activities are reported in a separate Statement of Fiduciary Net Position and Statement of Changes in Fiduciary Net Position. The City is fiduciary for resources collected and owed to others including developers and governmental agencies. We exclude these activities from the City’s other financial statements because the City cannot use these assets to finance operations. The City is responsible for ensuring that the assets reported in these funds are used for their intended purposes. The accounting used for fiduciary funds is much like that used for proprietary funds. The City as a Whole The City’s combined net position increased from $437,050,396 to $448,594,793 and maintained its financial position. A large part of this increase was due to positive performance in the General and Liquor funds. The General Fund had positive performance in licenses and permits, property tax revenue, charges for services, and investment income, which allowed the General fund to transfer $2,661,850 to the Capital Improvement Maintenance fund. Positive performance in the Liquor funds resulted in a transfer of $800,000 to the Capital Improvement Maintenance fund. . By far the largest portion of the City of Eden Prairie’s net position, $322,468,804 (approximately 72%) reflects its investment in capital assets (e.g. land, buildings, machinery, and equipment) less any related debt used to acquire those assets that is still outstanding. The City of Eden Prairie uses
26
City of Eden Prairie, Minnesota Management’s Discussion and Analysis these capital assets to provide services to citizens; consequently, these assets are not available for future spending. Although the City’s investment in its capital assets is reported net of related debt, the resources needed to repay this debt must be provided from other sources, since the capital assets themselves cannot be used to liquidate these liabilities. An additional portion of the City’s net position $17,982,996 (approximately 4%), represents resources that are subject to external restrictions on how they may be used. The remaining balance of unrestricted net position, $108,142,993 (approximately 24%), may be used to meet the City’s ongoing obligations to citizens and creditors. At the end of the current fiscal year, the City is able to report positive balances in all of the categories of net position reported for the government as a whole. The following schedule provides a summary of the City’s net position as of December 31, 2023 (in thousands):
Key elements of these changes are shown on the following page.
2023 2022 2023 2022 2023 2022
Current and Other Assets 119,343$ 118,804$ 48,460$ 46,335$ 167,803$ 165,139$
Capital Assets 237,603 232,059 114,358 111,070 351,961 343,129 Total Assets 356,946 350,863 162,818 157,405 519,764 508,268
Deferred Outflows 25,643 28,120 917 1,439 26,560 29,559
Total Assets and Deferred Outflows 382,589 378,983 163,735 158,844 546,324 537,827
Long-Term Liabilities Outstanding 45,701 71,304 15,708 17,857 61,409 89,161
Other Liabilities 6,064 6,930 1,912 1,877 7,976 8,807
Total Liabilities 51,765 78,234 17,620 19,734 69,385 97,968
Deferred Inflows 26,757 6,578 1,588 701 28,345 7,279
Total Liabilities and Deferred Inflows 78,522 84,812 19,208 20,435 97,730 105,247
Invested in Capital Assets 219,430 212,853 103,038 105,258 322,468 318,111
Restricted 17,983 16,290 - - 17,983 16,290
Unrestricted 66,654 65,028 41,489 33,151 108,143 98,179
Total Net Position 304,067$ 294,171$ 144,527$ 138,409$ 448,594$ 432,580$
Governmental Activities Business-Type activities Total
27
City of Eden Prairie, Minnesota Management’s Discussion and Analysis
2023 2022 2023 2022 2023 2022
Revenues:
Program Revenues
Charges for Services 13,009$ 13,343$ 35,505$ 34,364$ 48,514$ 47,707$
Operating Grants and
Contributions 3,228 6,799 45 107 3,273 6,906
Capital Grants and
Contributions 10,589 8,995 2,358 2,339 12,947 11,334
General Revenues
Property Taxes 44,020 43,333 - - 44,020 43,333
Tax Increment 2,577 2,750 - - 2,577 2,750
Gain on sale of Capital Assets 167 - 3 - 170 -
Grants and Contributions 565 972 117 - 682 972
Investment Income 4,005 (1,512) 1,841 (691) 5,846 (2,203)
Total Revenues 78,160 74,680 39,869 36,119 118,029 110,799
Expenses:
Administration 5,819 5,752 - - 5,819 5,752
Community Development 5,762 5,987 - - 5,762 5,987
Police 20,135 17,956 - - 20,135 17,956
Fire 7,372 5,689 - - 7,372 5,689
Public Works 13,712 16,584 - - 13,712 16,584
Parks and Recreation 17,801 17,932 - - 17,801 17,932
Interest on Long Term Debt 360 (126) - - 360 (126)
Water - - 13,276 13,549 13,276 13,549
Wastewater - - 7,692 8,375 7,692 8,375
Stormwater - - 3,268 3,170 3,268 3,170
Liquor - - 11,288 11,085 11,288 11,085
Total Expenses 70,961 69,774 35,524 36,179 106,485 105,953
Changes in Net Position
Before Transfers 7,199 4,906 4,345 (60) 11,544 4,846
Internal Transfers 1,748 4,339 (1,748) (4,339) - -
Change in Net Position 8,947 9,245 2,597 (4,399) 11,544 4,846
Net Position - Beginning 294,171 284,926 138,409 142,809 432,580 427,734
Prior Period Adjustment, as Restated 949 - 3,521 - 4,470 -
Net Position - Beginning Restated 295,120 284,926 141,930 142,809 437,050 427,734
Net Position, December 31 304,067$ 294,171$ 144,527$ 138,409$ 448,594$ 432,580$
Business-Type TotalGovernmental Activities
28
City of Eden Prairie, Minnesota Management’s Discussion and Analysis
Governmental Activities
Revenue by Source
• For the year, property taxes totaled $46,596,745 which is an increase of $3,263,522 or 7.5% from 2022. For 2023, the City budgeted for a 5.7% increase in property taxes. The increase in taxes was more than what was budgeted due to a higher tax collection rate than anticipated.
• Charges for services decreased by $334,364 or 2.5% from 2022 due mainly to decreased permit fee revenue.
• Operating grants and contributions decreased from 2022 by $3,571,352 due primarily to the $3.7M Cares Act Grant received in 2022 but not in 2023.
• Capital grants and contributions increased in 2023 by $1,593,670 due primarily to a rate increase in franchise fees for the Pavement Management fund.
29
City of Eden Prairie, Minnesota Management’s Discussion and Analysis
Expenses by Program
Business-type Activities For the business-type activities, charges for services accounts for 89.0% of revenues. The Water Fund, Wastewater Fund and Stormwater Fund had a change to net position of $528,765, $932,972 and $1,093,167. The Water and Wastewater fund’s increase in net position is mainly due to a 3% increase in rates and the increase in investment income. The Stormwater Fund’s increased net position is due to a 3% rate increase, investment income and fewer projects in 2023. The Liquor operations had a positive change in net position of $97,535.
30
City of Eden Prairie, Minnesota Management’s Discussion and Analysis
The City’s Funds The General fund is the chief operating fund of the City of Eden Prairie. Fund balance increased by $283,982. The City was able to maintain balances in accordance with its fund balance policy.
Non-spendable Balances The balances classified as non-spendable consist of balances that are not in spendable form, such as prepaid assets.
Restricted Balances The balances classified as restricted consist of balances related to externally imposed constraints established by creditors, grantors/contributors, or state statutory provisions.
31
City of Eden Prairie, Minnesota Management’s Discussion and Analysis
Unassigned Balances The unassigned fund balance consists of the residual classification for the general fund. The City maintained an unassigned fund balance in accordance with the City’s fund balance policy. Other Major Funds The Public Improvement Construction fund balance decreased by ($104,229) in 2023. Revenue of $814,635 was collected which consisted of special assessments and intergovernmental revenue. Construction costs include Pioneer Trail reconstruction and the Prairie Center Drive and Singletree Lane intersection. These projects will be repaid with future special assessments, grants and state aid. There was also a transfer in of $1,441,133 for the Pioneer Trail project. The Capital Improvement Maintenance fund balance increased by $4,030,055 in 2023. Revenue of $4,964,150 was collected which consists mainly of general property taxes, building rental income, intergovernmental revenue and investment income. Expenditures for the year include parks parking lot maintenance, Round Lake park building reconstruction, Willow Creek Bridge replacement and a new plow truck. Transfers in included $3,829,973 which consisted of $800,000 from the Liquor funds and $2,661,850 from the General fund due to positive operating results. $450,000 was transferred out for the Capital Improvement Maintenance’s Fund share of trail maintenance. The City’s proprietary funds provide the same type of information found in the government-wide financial statements, but in more detail. Water fund sales through December 31, 2023 totaled $11,831,046, which is an increase of $822,209 or 7.5% from 2022. Water usage increased from 2.39 billion gallons to 2.55 billion gallons. The change in sales can be attributed to an increase in rates along with an increase in consumption. Wastewater fund sales through December 31, 2023 totaled $7,725,339, which is an increase of $207,868 or 2.8% from 2022. Sewer usage decreased from 1.36 billion gallons to 1.35 billion gallons. The change in sales can be attributed to an increase in rates offset by a decrease in consumption. Stormwater fund sales through December 31, 2023 totaled $3,879,587 which is an increase of $109,025 or 2.9% from 2022. The increase is due to the rate increase. Liquor operations profit of $800,000 was transferred to the Capital Improvement Maintenance Fund. Sales totaled $11,766,007 which is an increase of $12,200 or .1% over 2022. The operation continues to provide value to customers and maintain customer loyalty.
32
City of Eden Prairie, Minnesota Management’s Discussion and Analysis
Budgetary Highlights The net change in fund balance to the General fund was $283,982. Revenues of $55,902,448 were recorded which is $3,023,703 more than budgeted. Property tax revenue, licenses and permits and intergovernmental revenue performed better than expected. Charges for services performed better than budget due to the increase in community center memberships and organized athletics after the effects of COVID in the past couple years. Investment Income also performed better than budgeted due to the Fed’s very aggressive rate hike cycle. Total expenditures equaled $53,401,278 or 98.0% of the budget. All departments have spent less than 100% of the amounts budgeted. Due to the positive General Fund performance, $2,681,850 was transferred to the Capital Improvement and Maintenance Fund to support the Capital Improvement Program. Capital Assets and Debt Administration
Capital Assets At the end of 2023, the city had $352 million invested in capital assets. Major capital assets added during the current fiscal year by fund include the following.
2023
Fund Project Name Additions
Fleet Capital Vehicle and Equipment Replacements 2,632,959$
Water Capital Water Meter Replacements 1,976,922
Park Improvement Round Lake Park Shelter 1,762,556
Water Capital Well 17 1,582,314
Capital Maintenance Round Lake Park Shelter 1,317,155
Shady Oak North W 62nd Street Reconstruction 574,371
Total 9,846,277$
33
City of Eden Prairie, Minnesota Management’s Discussion and Analysis Capital Assets (net of depreciation/amortization, in thousands)
The City has chosen to maintain infrastructure using the modified approach. This means the City does not depreciate the cost of infrastructure but maintains the system at a “very good condition” level or higher. Additional information on the modified approach can be found in Note 1 of this report and additional information on the City’s capital assets can be found in Note 4 of this report. The City’s policy is to achieve an average rating of 70 (very good condition) for all streets and trails. In the summer of 2022, the City conducted a physical condition assessment. This assessment will be performed every three years. As of December 31, 2022, the City’s infrastructure system was rated at a Pavement Condition Index (PCI) of 85.3%, which is higher than the City’s policy level. The City’s infrastructure is constantly deteriorating resulting from the following factors: (1) traffic using the system; (2) the sun’s ultra-violet rays drying out and breaking down the top layer of pavement; (3) utility company/private development trenching operations; (4) water damage from natural precipitation; and (5) frost heave. The City is continuously taking actions to prolong the life of the system through short-term maintenance activities such as pothole patching, crack sealing, seal coating, and overlaying. The City expended $4,755,130 on infrastructure maintenance for the year ending December 31, 2023. These expenditures delayed deterioration; and, the overall condition of the system was improved through these maintenance expenditures. The City has estimated that the amount of annual expenditures required to maintain the City’s infrastructure at the average PCI rating of very good is approximately $5,000,000.
Debt At year-end, the City had approximately $61 million in bonds and other long-term liabilities outstanding compared to $89 million last year. Long term liabilities decreased due to a decrease in the net pension and bonds liability. Refer to Note 10 – Long Term Debt.
2023 2022 2023 2022 2023 2022
Land & Land Improv.33,441$ 33,498$ 1,477$ 1,332$ 34,918$ 34,830$
Infrastructure 143,128 139,375 - - 143,128 139,375
Work in Progress 6,198 5,409 1,582 348 7,780 5,757
Distribution System - - 82,457 84,549 82,457 84,549
Buildings 42,847 44,914 18,426 19,588 61,273 64,502
Leased Buildings - - 1,084 1,279 1,084 1,279
Leased Equipment 74 98 - - 74 98
Subscription Assets 888 - - - 888 -
Leasehold Improvements - - - - - -
Machinery & Equipment 1,807 1,003 8,226 2,772 10,033 3,775
Autos 4,777 3,838 208 239 4,985 4,077
Other Assets 4,443 3,924 898 963 5,341 4,887
Total 237,603$ 232,059$ 114,358$ 111,070$ 351,961$ 343,129$
Governmental Activities Business-type Activities Total
34
City of Eden Prairie, Minnesota Management’s Discussion and Analysis
Economic Factors and Next Year’s Budgets The City’s elected officials consider many factors when adopting the budget and determining fees for service and fees that will be charged for the business-type activities. These factors include service levels, the tax impact on the median value home, commercial/industrial and household growth, and inflation. Currently, the 2024 general fund budgeted appropriations are $57,521,455 which is an increase of $3,079,048 or 5.7% from the 2023 budget. Revenues less expenses for 2024 are ($1,000,000). The City anticipates using American Recovery Plan funding to offset the revenue shortfalls.
Contacting the City’s Financial Management This financial report is designed to provide a general overview of the City’s finances for those interested in the government’s finances. If you have questions about this report or need additional financial information, contact the Finance Division at City of Eden Prairie, 8080 Mitchell Road, Eden Prairie, MN 55344.
35
This page is intentionally left blank
36
GOVERNMENT -WIDE
STATEMENTS
37
City of Eden Prairie, Minnesota
Statement of Net Position
December 31, 2023
Governmental Business-type
Activities Activities Total
ASSETS
Cash and Investments $102,242,364 $40,701,422 $142,943,786
ReceivablesAccounts (net of allow for uncollectible)3,266,365 3,755,552 7,021,917 Investment Interest 526,807 225,328 752,135
Lease Receivable Interest 22,252 1,333 23,585
Due From Other Governments 3,312,623 20,798 3,333,421
Unremitted Taxes 163,359 - 163,359
Delinquent Taxes 285,840 - 285,840
Unremitted Special Assessments 214 2,819 3,033
Delinquent Special Assessments 2,894 409,911 412,805
Special Assessments 1,584,565 740,611 2,325,176
Unavailable Special Assessments 1,162,402 444,686 1,607,088
Inventory 170,744 1,218,376 1,389,120
Net Pension Asset 803,054 - 803,054
Prepaid Items 797,898 447,854 1,245,752
Lease Receivable
Due Within One Year 455,444 104,448 559,892
Due in More Than One Year 3,738,711 387,640 4,126,351
Land Held for Resale 808,000 - 808,000
Capital Assets
Nondepreciable/Nonamortizable
Land 22,119,564 1,057,955 23,177,519
Infrastructure 143,127,977 - 143,127,977
Work in Progress 6,197,675 1,582,312 7,779,987
Depreciable/Amortizable Buildings, Property
and Equipment, Net 66,158,167 111,717,880 177,876,047
Total Assets 356,946,919 162,818,925 519,765,844
DEFERRED OUTFLOWS OF RESOURCES
Refunding of Debt 240,432 - 240,432
Other Post Employment Benefits 824,620 61,756 886,376
Pensions 24,577,677 855,480 25,433,157
Total Deferred Outflows of Resources 25,642,729 917,236 26,559,965
Total Assets and Deferred Outflows of Resources 382,589,648 163,736,161 546,325,809
Primary Government
The notes to the financial statements are an integral part of this statement
38
City of Eden Prairie, Minnesota
Statement of Net Position
December 31, 2023
Governmental Business-type
Activities Activities Total
LIABILITIES
Accounts and Contracts Payable 3,342,329 1,390,516 4,732,845
Claims Payable 6,348 - 6,348
Salaries Payable 1,134,134 198,710 1,332,844
Investment Interest Payable 7,714 - 7,714
Bond Interest Payable 172,893 81,709 254,602 IT Subscriptions Interest Payable 18,097 - 18,097 Lease Interest Payable 212 3,117 3,329
Due to Other Governments 323,870 228,947 552,817
Unearned Revenue 1,058,393 9,816 1,068,209
Total Other Post Employment Benefits Liability
Due Within One Year 23,107 1,444 24,551
Due in More Than One Year 2,749,272 223,371 2,972,643
Net Pension
Due in More Than One Year 22,862,558 3,293,399 26,155,957
IT Subscriptions Liabilities
Due Within One Year 257,317 - 257,317
Due in More Than One Year 584,770 - 584,770
Lease Liability Payable
Due Within One Year 23,617 179,888 203,505
Due in More Than One Year 51,986 970,850 1,022,836
Bonds Payable
Due Within One Year 2,544,000 665,000 3,209,000
Due in More Than One Year 13,823,643 9,934,698 23,758,341
Finance Purchases From Direct Borrowing
Due Within One Year 92,046 - 92,046
Due in More Than One Year 233,891 - 233,891
Compensated Absences
Due Within One Year 1,222,556 218,630 1,441,186
Due in More Than One Year 1,232,147 220,346 1,452,493
Total Liabilities 51,764,900 17,620,441 69,385,341
DEFERRED INFLOWS OF RESOURCES
Other Post Employment Benefits 827,423 56,778 884,201
Pensions 21,840,844 1,062,081 22,902,925
Deferred Inflows of Resources Related to
Lease Receivable 4,089,078 469,471 4,558,549
Total Deferred Inflows of Resources 26,757,345 1,588,330 28,345,675
Total Liabilities and Deferred Inflows 78,522,245 19,208,771 97,731,016
NET POSITION
Net Investment in Capital Assets 219,430,606 103,038,198 322,468,804
Restricted for Perpetual Care, Nonexpendable 201,349 - 201,349
Restricted for Debt Service 4,363,992 - 4,363,992
Restricted for Special Assessments 11,540 - 11,540
Restricted for Tax Increment 3,901,204 - 3,901,204
Restricted for Fire Relief 3,675,871 - 3,675,871
Restricted for Police 387,503 - 387,503
Restricted for Public Works 1,482,020 - 1,482,020
Restricted for Parks and Recreation 3,947,651 - 3,947,651
Restricted for Historical and Cultural 11,866 - 11,866
Unrestricted 66,653,801 41,489,192 108,142,993
Total Net Position $304,067,403 $144,527,390 $448,594,793
Primary Government
The notes to the financial statements are an integral part of this statement 39
City of Eden Prairie, Minnesota
Statement of Activities
For the Year Ended December 31, 2023
Program Revenue
Operating Capital
Charges for Grants and Grants and
Expenses Services Contributions Contributions
FUNCTIONS/PROGRAMS
Primary Government
Governmental Activities
Administration $5,819,132 $932,607 $17,259 $-
Community Development 5,762,042 76,298 703,605 67,000
Police 20,135,104 991,422 1,072,863 205,706
Fire 7,371,601 3,719,560 712,359 -
Public Works 13,711,989 368,949 500,331 10,271,637
Parks and Recreation 17,801,245 6,920,145 221,039 44,422
Interest on Long Term Debt 359,725 - - -
Total Governmental Activities 70,960,838 13,008,981 3,227,456 10,588,765
Business-Type Activities
Water 13,276,328 11,831,046 11,333 1,393,681
Wastewater 7,692,294 7,725,339 8,717 638,742
Stormwater 3,268,137 3,879,587 20,026 325,543
Liquor 11,287,849 12,069,015 5,239 -
Total Business-Type Activities 35,524,608 35,504,987 45,315 2,357,966
Total Primary Government $106,485,446 $48,513,968 $3,272,771 $12,946,731
General Revenues
Taxes
Property Taxes, Levied for General Purposes
Property Taxes, Levied for Debt Service
Tax Increment
Gain on Sale of Capital Asset
Grants and Contributions Not Restricted to Specific Programs
Investment Income
Transfers
Total General Revenues and Transfers
Change in Net Position
Net Position - Beginning
Prior Period Adjustment, as Restated (See Note 17)
Net Position - Beginning Restated
Net Position - Ending
The notes to the financial statements are an integral part of this statement
40
Net (Expense) Revenue
and Changes in Net Position
Governmental Business-type
Activities Activities Total
$(4,869,266) $- $(4,869,266)
(4,915,139) - (4,915,139)
(17,865,113) - (17,865,113)
(2,939,682) - (2,939,682)
(2,571,072) - (2,571,072)
(10,615,639) - (10,615,639)
(359,725) - (359,725)
(44,135,636) - (44,135,636)
- (40,268) (40,268)
- 680,504 680,504
- 957,019 957,019
- 786,405 786,405
- 2,383,660 2,383,660
(44,135,636) 2,383,660 (41,751,976)
41,486,708 - 41,486,708
2,533,046 - 2,533,046
2,576,991 - 2,576,991
167,444 3,563 171,007
565,167 117,647 682,814
4,004,805 1,841,002 5,845,807
1,748,321 (1,748,321) -
53,082,482 213,891 53,296,373
8,946,846 2,597,551 11,544,397
294,171,398 138,409,349 432,580,747
949,159 3,520,490 4,469,649
295,120,557 141,929,839 437,050,396
$304,067,403 $144,527,390 $448,594,793
The notes to the financial statements are an integral part of this statement
41
This page is intentionally left blank
42
FUND FINANCIAL
STATEMENTS
43
City of Eden Prairie, Minnesota
Balance Sheet
Governmental Funds
December 31, 2023
Public Capital Other TotalImprovementImprovementGovernmentalGovernmental
General Construction Maintenance Funds Funds
ASSETS
Cash and Investments $35,561,962 $- $28,156,231 $24,885,515 $88,603,708
ReceivablesAccounts 550,610 - - 1,401,403 1,952,013
Lease Receivable - - 368,281 86,867 455,148 Investment Interest 158,763 - 138,793 151,396 448,952 Lease Receivable Interest - - 18,377 2,265 20,642
Due From Other Governments 216,604 - 2,496,100 561,361 3,274,065 Unremitted Taxes 121,643 - 1,149 40,567 163,359
Delinquent Taxes 283,141 - 2,699 - 285,840 Unremitted Special Assessments 208 6 - - 214 Delinquent Special Assessments 2,330 - 247 317 2,894
Deferred Special Assessments 13,704 89,659 126,450 1,354,752 1,584,565 Special Deferred Special Assessments - 159,706 61,582 941,114 1,162,402
Due From Other Funds - - 473,151 66,507 539,658 Prepaid Items 109,576 - 14,600 60,923 185,099 Lease Receivable - - 3,426,622 279,283 3,705,905 Land Held for Resale - - - 808,000 808,000
Notes Receivable (net of allow for uncollectible)- - - 1,212,024 1,212,024 Total Assets $37,018,541 $249,371 $35,284,282 $31,852,294 $104,404,488
LIABILITIES
Accounts and Contracts Payable $1,726,139 $38,476 $47,020 $344,183 $2,155,818 Salaries Payable 1,029,887 - - 11,252 1,041,139 Investment Interest Payable - 6,214 - 506 6,720 Due to Other Governments 88,929 - - 10,617 99,546
Due to Other Funds - 473,151 - 66,507 539,658 Unearned Revenue 155,204 - 119,534 783,655 1,058,393
Total Liabilities 3,000,159 517,841 166,554 1,216,720 4,901,274
DEFERRED INFLOWS OF RESOURCES
Deferred Inflow of Resource Related to Lease Receivable - - 3,693,281 364,814 4,058,095
Unavailable Revenue 2,540 - - 375 2,915
Unavailable Revenue - State Shared Taxes - - 2,496,100 - 2,496,100
Unavailable Revenue-Property Taxes 283,141 - 2,699 - 285,840 Unavailable Revenue-Special Assessments 16,034 249,365 188,279 2,296,183 2,749,861
Total Deferred Inflows of Resources 301,715 249,365 6,380,359 2,661,372 9,592,811
FUND BALANCESNonspendable 109,576 - 14,600 262,272 386,448
Restricted - - - 12,965,377 12,965,377 Assigned - - 28,722,769 14,792,512 43,515,281
Unassigned 33,607,091 (517,835) - (45,959) 33,043,297 Total Fund Balance 33,716,667 (517,835) 28,737,369 27,974,202 89,910,403
Total Liabilities, Deferred Inflows of Resources, and Fund Balance $37,018,541 $249,371 $35,284,282 $31,852,294 $104,404,488
Capital Projects
The notes to the financial statements are an integral part of this statement
44
City of Eden Prairie, Minnesota
Governmental Funds
Reconciliation of the Balance Sheet of Governmental Funds
to the Statement of Net Position
December 31, 2023
Amounts Reported for Governmental Activities in the Statement of Net Position are Different Because:
Total Fund Balance - Governmental Funds $89,910,403
1.Capital assets used in Governmental Activities are not financial resources and
therefore are not reported as assets in governmental funds.
Cost of Capital Assets 286,331,144
Less Accumulated Depreciation (58,274,747)
2.Long term liabilities, including bonds payable, are not due and payable in the
current period and therefore are not reported as liabilities in the funds.
Long-term liabilities at year end consist of:
Bond Principal Payable Net (16,367,643)
Finance Purchases From Direct Borrowing (325,937)
Subscription Liablity (23,691)
Deferred Gain on Refunding 240,432
3.The City's net pension liability, net pension asset and related deferred outflows and
inflows of resources are recorded only on the Statement of Net Position
Balances at year end are:
Net Pension Asset 803,054
Deferred Outflows of Resources related to pensions 24,577,677
Net Pension Liability (22,862,558)
Deferred Inflows of Resources related to pensions (21,840,844)
4.Taxes and special assessment receivable will be collected in future years, but are
not available soon enough to pay for the current period's expenditures and therefore
are deferred in the funds.3,035,701
5.Receivable will be collected in future years, but are not available soon enough
to pay for the current period's expenditures and therefore are deferred in the funds.2,499,015
6.Governmental funds do not report a liability for accrued interest on long-term debt
until due and payable.(172,893)
7.Internal Service Funds are used by management to charge the costs of employee
benefits to individual funds. The assets and liabilities of the Internal Service Fund
are included in Governmental Activities in the Statement of Net Position.16,081,235
8.Internal Service Funds are used by management to charge the costs of employee
benefits to individual funds. The assets and liabilities of the Internal Service Fund
are included in Business-type Activities in the Statement of Net Position.457,055
Net Position - Governmental Activities $304,067,403
The notes to the financial statements are an integral part of this statement
45
City of Eden Prairie, Minnesota
Statement of Revenues, Expenditures
and Changes in Fund Balances
Governmental Funds
For the Year Ended December 31, 2023
Public Capital Other TotalImprovementImprovementGovernmentalGovernmental
General Construction Maintenance Funds Funds
REVENUES
General Property Taxes $41,383,475 $- $393,087 $5,312,877 $47,089,439
Special Assessments 30,897 182,095 14,570 560,257 787,819 Penalties and Interest 11,606 - - - 11,606
Licenses and Permits 5,054,344 - - 4,803,077 9,857,421 Intergovernmental Revenue 1,822,526 664,455 2,806,873 2,393,860 7,687,714
Charges for Services 5,817,974 - - 1,253,385 7,071,359
Fines and Forfeits 349,641 - - 2,250 351,891
Investment Income 1,190,635 (31,915) 1,147,864 1,069,224 3,375,808 Lease Income - - 107,640 12,479 120,119
Rental - - 483,437 81,730 565,167
Other 241,350 - 10,679 403,203 655,232 Total Revenues 55,902,448 814,635 4,964,150 15,892,342 77,573,575
EXPENDITURES
Current
Administration 4,890,058 - 633,613 - 5,523,671 Community Development 2,561,689 - - 3,120,475 5,682,164 Police 17,854,145 - - 261,979 18,116,124
Fire 6,760,050 - - - 6,760,050 Public Works 6,792,740 - - 60,516 6,853,256
Parks and Recreation 14,440,321 - - 65,819 14,506,140 Capital Outlay
Administration - - - 26,646 26,646 Community Development - - - 143,885 143,885
Police - - 152,264 36,491 188,755 Fire - - 205,220 - 205,220 Public Works - 2,359,997 1,187,109 5,342,028 8,889,134
Parks and Recreation - - 2,135,862 2,254,644 4,390,506 Debt Service
Principal 92,200 - - 2,489,486 2,581,686 Interest 10,075 - - 447,945 458,020
Fiscal Agent Fees - - - 5,099 5,099 Total Expenditures 53,401,278 2,359,997 4,314,068 14,255,013 74,330,356
Excess of Revenues Over (Under) Expenditures 2,501,170 (1,545,362) 650,082 1,637,329 3,243,219
OTHER FINANCING SOURCES (USES)
Issuance of Debt - - - 36,491 36,491 Transfers In 464,662 1,441,133 3,829,973 5,532,179 11,267,947
Transfers Out (2,681,850) - (450,000) (5,602,213) (8,734,063) Total Other Financing Sources (Uses)(2,217,188) 1,441,133 3,379,973 (33,543) 2,570,375
Net Change in Fund Balances 283,982 (104,229) 4,030,055 1,603,786 5,813,594
Fund Balance (Deficit) - Beginning 33,432,685 (413,606) 24,707,314 26,370,416 84,096,809
Fund Balance (Deficit) - Ending $33,716,667 $(517,835) $28,737,369 $27,974,202 $89,910,403
Capital Projects
The notes to the financial statements are an integral part of this statement
46
City of Eden Prairie, Minnesota
Reconciliation of the Statement of Revenues and Expenditures, and Changes in Fund
Balances of Governmental Funds to the Statement of Activities
For the Year Ended December 31, 2023
Total net change in fund balances - governmental funds $5,813,594
Amounts Reported for Governmental Activities in the Statement of Activities are Different Because:
Capital outlays are reported in Governmental Funds as expenditures. However, in the Statement of
Activities, the cost of those assets is allocated over the estimated useful life's as depreciation expense.
Capital Outlays 6,267,351 Depreciation/Amortization Expense (4,282,029) The net effect of the disposal of capital assets
Contributed to Enterprise funds (785,563)
Disposals (446,169)
Accumulated Depreciation/Amortization on Disposals 433,936
Principal payments of long-term debt and SBITAs consumes the current financial resources of Governmental
Funds, However they have no effect on Net Position.2,576,000
Interest on long-term debt in the statement of activities differs from the amount reported in the Governmental Funds because interest is recognized as an expenditure in the funds when it is due thus requires use of current financial resources. In the Statement of Activities, however interest
expense is recognized as the interest accrues, regardless of when it is due.17,620
The issuance of long-term debt and SBITAs provides current financial resources to Governmental Funds and has no effect on Net Position. These amounts are reported in the Governmental Funds as a source of financing. These amounts are not shown as revenue in the Statement of Activities, but rather
constitute long-term liabilities in the Statement of Net Position.(36,491)
Governmental Funds report debt issuance premiums and discounts as another financing source oruse at the time of issuance. Premiums and discounts are reported as an unamortized asset or liabilityin the Government-wide financial statements.113,317
Refunding gains/(losses) are recognized when paid in the governmental funds but amortized over the life of the
debt in the Statement of Activities.Amortization of Deferred Gain (21,857)
Taxes and special assessments receivable will be collected in future years, but are not available soon
enough to pay for the current period's expenditures, and therefore are deferred in the funds.(1,445,856)
Receivable will be collected in future years, but are not available soon enough to pay for the current period's expenditures, and therefore are deferred in the funds.1,225,132
Some pension expenses reported in the Statement of Activities do not require the use of
current financial resources and, therefore are not reported as expenditures.Change in Net Pension Asset/Liability and Related Deferred Outflows/Inflows of Resources (2,214,161)
Internal Service Funds are used by management to charge the costs of employee benefits to individual
funds. The net revenue of these activities is reported in Governmental Activities.1,677,134
Internal Service Funds are used by management to charge the costs of employee benefits to individual funds. The net revenue of these activities is reported in Business Type Activities.54,888
Change in Net Position - Governmental Activities $8,946,846
The notes to the financial statements are an integral part of this statement
47
This page is intentionally left blank
48
City of Eden Prairie, Minnesota
General Fund
Statement of Revenues, Expenditures and
Changes in Fund Balance - Budget and Actual
For the Year Ended December 31, 2023
With Comparative Actual Amounts For the Year Ended December 31, 2022
2022
Budget Budget Variance
Original Final Actual Over/(Under)Actual
REVENUES
Taxes and Special AssessmentsGeneral Property Taxes and Assessments $41,117,158 $41,117,158 $41,414,372 $297,214 $39,704,702 Penalties and Interest 25,000 25,000 11,606 (13,394) 22,551 Total Taxes and Special Assessments 41,142,158 41,142,158 41,425,978 283,820 39,727,253
Licenses and PermitsLiquor, Beer and Wine Licenses 311,650 311,650 309,450 (2,200) 298,029 Other Licenses 44,425 44,425 30,342 (14,083) 39,036
Building Permits and Fees 2,524,975 2,524,975 3,562,908 1,037,933 3,836,375
Cable TV 791,000 791,000 733,781 (57,219) 759,370
Other Permits
Inspection Fees 245,000 245,000 244,160 (840) 209,223
Non-Development Fire Permits 113,500 113,500 130,295 16,795 119,744 Other 38,150 38,150 43,408 5,258 41,690 Total Licenses and Permits 4,068,700 4,068,700 5,054,344 985,644 5,303,467
Intergovernmental RevenuePolice Pension Aid 610,000 610,000 728,684 118,684 651,068 Fire Relief Association Aid 494,000 494,000 600,218 106,218 542,833 School Liaison 128,300 128,300 - (128,300) 124,600
Police Training 65,000 65,000 69,704 4,704 65,963
Fire Training 25,000 25,000 112,142 87,142 16,820
Grants 70,000 70,000 302,815 232,815 3,935,576
Local Performance Aid 9,000 9,000 8,963 (37) 8,980
Total Intergovernmental Revenue 1,401,300 1,401,300 1,822,526 421,226 5,345,840
Charges for Services
Public Safety 172,533 172,533 242,495 69,962 213,151
Recreation
Community Center 4,233,054 4,233,054 4,331,204 98,150 3,845,607 Youth Programs 497,500 497,500 552,300 54,800 471,568 Organized Athletics 208,900 208,900 161,110 (47,790) 154,295 Senior Center 77,800 77,800 69,413 (8,387) 59,178
Outdoor Center 75,500 75,500 81,018 5,518 84,818
Arts Center 109,200 109,200 195,924 86,724 201,829
Park Facilities 82,000 82,000 85,204 3,204 80,085
Park Maintenance 43,300 43,300 40,825 (2,475) 36,941
Therapeutic Recreation 38,500 38,500 24,979 (13,521) 21,742 Arts 27,400 27,400 33,322 5,922 31,764 Special Events 5,600 5,600 180 (5,420) 270 Total Recreation 5,398,754 5,398,754 5,575,479 176,725 4,988,097
Total Charges for Services 5,571,287 5,571,287 5,817,974 246,687 5,201,248
Fines and Forfeits 367,000 367,000 349,641 (17,359) 296,757
Investment Income 150,000 150,000 1,190,635 1,040,635 (468,510)
Other 178,300 178,300 241,350 63,050 231,252
Total Revenues $52,878,745 $52,878,745 $55,902,448 $3,023,703 $55,637,307
2023
The notes to the financial statements are an integral part of this statement
49
City of Eden Prairie, Minnesota
General Fund
Statement of Revenues, Expenditures and
Changed in Fund Balance - Budget and Actual
For the Year Ended December 31, 2023 Continued
With Comparative Actual Amounts For the Year Ended December 31, 2022
2022
Budget Budget Variance
Original Final Actual Over/(Under)Actual
EXPENDITURES
Current
AdministrationLegislative $358,635 $358,635 $364,911 $6,276 $377,212 Office of the City Manager 500,720 500,720 433,417 (67,303) 408,807 Legal Counsel 575,000 575,000 678,299 103,299 499,784 City Clerk 191,065 191,065 182,306 (8,759) 358,716 Communications 727,187 727,187 724,688 (2,499) 691,641 Finance 976,514 976,514 964,624 (11,890) 931,975 Customer Service 410,876 410,876 385,964 (24,912) 389,406 Human Resources 1,223,369 1,223,369 1,155,849 (67,520) 1,223,047 Total Administration 4,963,366 4,963,366 4,890,058 (73,308) 4,880,588
Community Development
Assessing 1,135,558 1,135,558 1,131,997 (3,561) 1,055,993
Planning 730,797 730,797 646,085 (84,712) 574,623
Community Development Administration 267,283 267,283 240,752 (26,531) 231,497
Economic Development 174,877 174,877 172,214 (2,663) 186,083
Housing & Community Services 372,605 372,605 370,641 (1,964) 364,744
Total Community Development 2,681,120 2,681,120 2,561,689 (119,431) 2,412,940
Police 18,162,956 18,162,956 17,854,145 (308,811) 17,032,495
FireFire 5,349,449 5,349,449 5,252,294 (97,155) 5,369,294 Inspections 1,389,418 1,389,418 1,357,905 (31,513) 1,327,290 Public Safety Communications 153,680 153,680 149,851 (3,829) 144,835 Total Fire 6,892,547 6,892,547 6,760,050 (132,497) 6,841,419
Public Works
Engineering 1,369,704 1,390,954 1,331,320 (59,634) 1,280,818
Street Maintenance 4,608,644 4,608,644 4,551,891 (56,753) 4,298,081
Street Lighting 1,023,500 1,023,500 909,529 (113,971) 983,693
Total Public Works 7,001,848 7,023,098 6,792,740 (230,358) 6,562,592
2023
The notes to the financial statements are an integral part of this statement
50
City of Eden Prairie, Minnesota
General Fund
Statement of Revenues, Expenditures and
Changed in Fund Balance - Budget and Actual
For the Year Ended December 31, 2023 Continued
With Comparative Actual Amounts For the Year Ended December 31, 2022
2022
Budget Budget Variance
Original Final Actual Over/(Under)Actual
2023
EXPENDITURES (Continued)
Current (Continued)
Parks and Recreation
Park Maintenance 4,936,972 4,936,972 5,015,348 78,376 4,808,144
Community Center 5,885,462 5,885,462 5,707,115 (178,347) 5,351,320
Youth Programs 707,191 707,191 718,720 11,529 700,406
Senior Center 500,519 500,519 484,722 (15,797) 453,463
Park Administration 484,185 484,185 486,727 2,542 444,131
Organized Athletics 284,220 284,220 261,686 (22,534) 223,960
Recreation Administration 417,381 417,381 365,896 (51,485) 335,449
Arts Center 369,864 369,864 478,706 108,842 431,491
Therapeutic Recreation 247,286 247,286 185,314 (61,972) 161,265
Outdoor Center 273,756 273,756 272,606 (1,150) 282,369
Arts 170,649 170,649 180,542 9,893 161,958
Special Events 153,284 153,284 145,981 (7,303) 145,431
Park Facilities 96,688 96,688 87,626 (9,062) 81,114
Beaches 99,763 99,763 49,332 (50,431) 54,617
Total Parks and Recreation 14,627,220 14,627,220 14,440,321 (186,899) 13,635,118
Debt Service
Principal 86,241 86,241 92,200 5,959 18,819
Interest 7,109 7,109 10,075 2,966 1,843
Total Debt Service 93,350 93,350 102,275 8,925 20,662
Total Expenditures 54,422,407 54,443,657 53,401,278 (1,042,379) 51,385,814
Excess of Revenues Over (Under) Expenditures (1,543,662) (1,564,912) 2,501,170 4,066,082 4,251,493
OTHER FINANCING SOURCES / (USES)
Issuance of Debt - - - - 436,955 Transfers In 463,662 463,662 464,662 1,000 444,324Transfers Out (20,000) (20,000)(2,681,850)(2,661,850) (1,020,000)Total Other Financing Sources / (Uses)443,662 443,662 (2,217,188) (2,660,850) (138,721)
Net Change in Fund Balance $(1,100,000) $(1,121,250) 283,982 $1,405,232 4,112,772
Fund Balance, January 1 33,432,685 29,319,913
Fund Balance, December 31 $33,716,667 $33,432,685
The notes to the financial statements are an integral part of this statement
51
City of Eden Prairie, Minnesota
Proprietary Funds
Statement of Net Position
December 31, 2023
Governmental
Activities
InternalWaterWastewaterStormwaterLiquorServiceFundFundFundFundTotalsFund
ASSETSCurrent Assets:Cash and Investments $20,467,342 $11,417,839 $6,533,094 $2,740,202 $41,158,477 $13,181,601 Receivables:Accounts 1,590,337 1,395,433 746,329 23,453 3,755,552 102,328 Lease Receivable - - - 104,448 104,448 296 Investment Interest 114,469 59,230 36,922 14,707 225,328 77,855 Lease Receivable Interest - - - 1,333 1,333 1,610 Due From Other Governments 19,798 - 1,000 - 20,798 38,558 Unremitted Special Assessments 2,523 296 - - 2,819 - Delinquent Special Assessments 396,858 9,391 3,662 - 409,911 -
Deferred Special Assessments 241,090 317,085 182,436 - 740,611 -
Special Deferred Special Assessments 193,593 251,093 - - 444,686 -
Due From Other Funds - - - - - 557,359
Inventory - - - 1,218,376 1,218,376 170,744
Prepaid Items 30,854 383,901 - 33,099 447,854 612,799 Total Current Assets 23,056,864 13,834,268 7,503,443 4,135,618 48,530,193 14,743,150 Noncurrent AssetsLease Receivable - - - 387,640 387,640 32,806 Capital Assets:Not Being Depreciated or AmortizedLand 410,694 - 110,602 536,659 1,057,955 - Work in Progress 1,582,312 - - - 1,582,312 1,228,992 Depreciated or AmortizedProperty, Plant and Equipment 147,287,697 83,914,640 54,326,188 2,628,498 288,157,023 16,826,318 Leased IT Subscriptions - - - - - 1,160,733 Leased Building/Equipment - - - 1,474,097 1,474,097 116,896 Less Accumulated Depreciation/Amortization (90,653,586) (55,504,356) (29,726,925) (2,028,373) (177,913,240) (9,785,953)
Total Noncurrent Assets 58,627,117 28,410,284 24,709,865 2,998,521 114,745,787 9,579,792
Total Assets 81,683,981 42,244,552 32,213,308 7,134,139 163,275,980 24,322,942
DEFERRED OUTFLOWS OF RESOURCESOther Post Employment Benefits 39,905 10,156 3,452 8,243 61,756 824,620 Pensions 463,385 106,935 106,935 178,225 855,480 - Total Deferred Outflows of Resources 503,290 117,091 110,387 186,468 917,236 824,620
Total Assets and Deferred Outflows of Resources 82,187,271 42,361,643 32,323,695 7,320,607 164,193,216 25,147,562
LIABILITIES
Current Liabilities:
Accounts Payable 737,747 98,652 77,659 476,458 1,390,516 1,186,511 Claims Payable - - - - - 6,348 Salaries Payable 93,850 29,472 22,346 53,042 198,710 92,995 Investment Interest Payable - - - - - 994 IT Subscriptions Interest Payable - - - - - 18,097 IT Subscriptions Liabilities - - - - - 245,779 Bond Interest Payable 81,709 - - - 81,709 - Lease Interest Payable - - - 3,117 3,117 212 Due to Other Governments 76,202 - - 152,745 228,947 224,324 Due to Other Funds - - - - - 557,359 Unearned Revenue - - - 9,816 9,816 - Current Other Postemployment Benefits Liability 943 246 64 191 1,444 23,107 Current Lease Liability Payable - - - 179,888 179,888 23,617 Current Portion of Bonds Payable 665,000 - - - 665,000 - Current Portion of Compensated Absences 114,831 32,994 10,345 60,460 218,630 1,222,556 Total Current Liabilities 1,770,282 161,364 110,414 935,717 2,977,777 3,601,899 Noncurrent Liabilities:Total Other Postemployment Benefits Liability 137,682 38,652 20,327 26,710 223,371 2,749,272 IT Subscriptions Liabilities - - - - - 572,617 Net Pension Liability 1,783,924 411,675 411,675 686,125 3,293,399 -
Lease Liability Payable - - - 970,850 970,850 51,986
Bonds Payable 9,934,698 - - - 9,934,698 -
Compensated Absences 115,732 33,252 10,427 60,935 220,346 1,232,147
Total Noncurrent Liabilities 11,972,036 483,579 442,429 1,744,620 14,642,664 4,606,022
Total Liabilities 13,742,318 644,943 552,843 2,680,337 17,620,441 8,207,921
DEFERRED INFLOWS OF RESOURCES
Other Postemployment Benefits Liability 36,859 9,488 2,879 7,552 56,778 827,423 Pensions 575,294 132,760 132,760 221,267 1,062,081 - Deferred Inflow of Resource Related to Lease Receivable - - - 469,471 469,471 30,983 Total Deferred Inflows of Resources 612,153 142,248 135,639 698,290 1,588,330 858,406
Total Liabilities and Deferred Inflows of Resources 14,354,471 787,191 688,482 3,378,627 19,208,771 9,066,327
NET POSITIONNet Investment in Capital Assets 48,457,906 28,410,284 24,709,865 1,460,143 103,038,198 8,022,976 Unrestricted 19,374,894 13,164,168 6,925,348 2,481,837 41,946,247 8,058,259 Total Net Position $67,832,800 $41,574,452 $31,635,213 $3,941,980 144,984,445 $16,081,235
Adjustment to Reflect the Consolidation of Internal Service Fund Activities Related to Enterprise Funds (457,055)
Total Net Position-Business-Type Activities $144,527,390
The notes to the financial statements are an integral part of this statement
52
City of Eden Prairie, Minnesota
Proprietary Funds
Statement of Revenues, Expenses and
Changes in Net Position
For the Year Ended December 31, 2023
Governmental
Activities -Internal
Water Wastewater Stormwater Liquor ServiceFundFundFundFundTotalFund
SALES AND COST OF SALESSales $- $- $- $11,766,007 $11,766,007 $-
Cost of Sales - - - (8,470,531) (8,470,531) - Gross Profit - - - 3,295,476 3,295,476 -
OPERATING REVENUESales 11,810,456 7,725,239 3,879,587 - 23,415,282 -
Charges for Services - - - - - 21,193,334 Rental - - - 245,056 245,056 622,325
Lease Receivable Interest - - - 17,646 17,646 1,110 Other 20,590 100 - 40,306 60,996 - Total Operating Revenues 11,831,046 7,725,339 3,879,587 303,008 23,738,980 21,816,769
OPERATING EXPENSE
Personnel Services 3,265,298 1,004,127 742,586 1,456,148 6,468,159 10,063,310 SuppliesSupplies 107,042 14,793 37,600 31,263 190,698 83,310
Cleaning Supplies 13,947 - - - 13,947 98,290 Motor Fuel - - - - - 505,929 Tires - - - - - 75,161
Chemicals 1,256,070 - - - 1,256,070 - Repair and Maintenance Supplies 318,178 21,283 32,993 1,242 373,696 714,087 Contractual ServicesContractual Services 494,114 160,840 649,943 383,877 1,688,774 4,199,845 Software 67,200 67,200 - 148 134,548 1,198,092 Janitorial Services 55,200 - - 27,712 82,912 892,553 Lime Residual Removal 380,617 - - - 380,617 - Building Rent - - - 96,120 96,120 - Licenses, Permits, Taxes 264,694 47 1,090 60 265,891 3,704 Repair and Maintenance 520,928 47,406 18,661 - 586,995 293,147 Utilities 1,087,514 28,016 1,070 77,534 1,194,134 1,647,784 MCES Fees - 4,458,823 - - 4,458,823 - Bank and Credit Card Fees 69,176 69,176 - 271,838 410,190 -
User Charges 430,913 341,127 210,552 180,633 1,163,225 23,427 Capital Under $25,000 1,640,463 80,500 492,799 27,230 2,240,992 481,775 Total Operating Expenses 9,971,354 6,293,338 2,187,294 2,553,805 21,005,791 20,280,414
Operating Income (Loss) Before Depreciation/Amortization 1,859,692 1,432,001 1,692,293 1,044,679 6,028,665 1,536,355
Depreciation/Amortization 3,065,370 1,377,115 1,042,310 232,829 5,717,624 1,327,853
Operating Income (Loss) Before Nonoperating
Revenue / Expense (1,205,678) 54,886 649,983 811,850 311,041 208,502
NONOPERATING REVENUE (EXPENSE)
Grants 24,599 39,428 53,620 - 117,647 - Investment Income 951,850 449,129 319,727 120,296 1,841,002 639,068
Lease Interest Expense - - - (39,850) (39,850) (2,902) Subscription Interest Expense - - - - - (31,895) Bonds Interest (287,173) - - - (287,173) - Bond Issuance Cost 52,569 - - - 52,569 - Fiscal Agent Fees (1,320) - - - (1,320) - Gain/(Loss) on Disposition of Capital Assets - 3,563 - - 3,563 179,677 Contributions - - - - - 2,673 Miscellaneous 11,333 8,717 20,026 5,239 45,315 321,205 Total Nonoperating Revenues (Expenses)751,858 500,837 393,373 85,685 1,731,753 1,107,826
Income (Loss) Before Contributions and Transfers (453,820) 555,723 1,043,356 897,535 2,042,794 1,316,328
Contributions - from Governmental Activities 61,864 70,118 653,581 - 785,563 360,806
Contributions - from Developers 190,738 213,462 276,038 - 680,238 - Capital Access Charges 955,010 233,370 - - 1,188,380 -
Capital Special Assessments 247,933 191,910 49,505 - 489,348 - Transfers Out (472,960) (331,611) (929,313) (800,000) (2,533,884) -
Change in Net Position 528,765 932,972 1,093,167 97,535 2,652,439 1,677,134
Net Position - Beginning 63,783,545 40,641,480 30,542,046 3,844,445 138,811,516 14,241,204
Prior Period Adjustment (See Note 17)3,520,490 - - - 3,520,490 162,897
Net Position - Beginning (Restated)67,304,035 40,641,480 30,542,046 3,844,445 142,332,006 14,404,101
Net Position - Ending $67,832,800 $41,574,452 $31,635,213 $3,941,980 144,984,445 $16,081,235
Amounts reported for Business Type Activities in the Statement of Activities are Different Because:Adjustment to Reflect the Consolidation of Internal Service Funds Activities Related To Enterprise Funds (54,888) Change in Net Position of Business-Type Activities 2,597,551$
The notes to the financial statements are an integral part of this statement
53
City of Eden Prairie, Minnesota
Proprietary Funds
Statement of Cash Flows
For the Year Ended December 31, 2023 Page 1 of 2
Governmental
Activities -
Internal Water Wastewater Stormwater Liquor Service
Fund Fund Fund Fund Totals Fund
CASH FLOWS FROM OPERATING ACTIVITIES
Receipts From Customers $11,657,429 $7,616,768 $3,854,124 $12,036,146 $35,164,467 $21,116,153
Payments to Vendors (6,683,072) (5,264,153) (1,388,620) (9,650,224) (22,986,069) (9,693,520) Payments to Employees (3,161,737) (973,935) (718,294) (1,388,671) (6,242,637) (10,000,025) Other Receipts 20,590 100 - 9,267 29,957 621,561
Net Cash Provided (Used) By Operating Activities 1,833,210 1,378,780 1,747,210 1,006,518 5,965,718 2,044,169
CASH FLOWS FROM INVESTING ACTIVITIES
Investment Income 900,336 417,530 304,562 113,450 1,735,878 604,467
Net Cash Provided (Used) By Investing Activities 900,336 417,530 304,562 113,450 1,735,878 604,467
CASH FLOWS FROM NONCAPITAL FINANCING ACTIVITIESGrants 24,599 39,428 53,620 - 117,647 -
Miscellaneous 11,333 8,717 20,026 5,239 45,315 323,878
Payments From Other Funds - - - - - (557,359)
Payments to Other Funds - - - - - 557,359
Transfers (Out)(472,960) (331,611) (929,313) (800,000) (2,533,884) -
Net Cash Provided (Used) By Noncapital Financing Activities (437,028) (283,466) (855,667) (794,761) (2,370,922) 323,878
CASH FLOWS FROM CAPITAL FINANCING ACTIVITESContributions - - - - - (3,202,931)
Acquisition and Construction of Capital Assets (3,970,658) - (48,500) - (4,019,158) -
Proceeds From Sale of Equipment - 3,563 - - 3,563 168,916
Access Charges 955,010 233,370 - - 1,188,380 -
Special Assessments 247,933 191,910 49,505 - 489,348 -
Principal Paid on Debt (620,000) - - (163,601) (783,601) (365,176) Interest and Fiscal Agent Paid on Debt (295,255) - - (40,293) (335,548) (16,764)
Net Cash Provided (Used) By Capital Financing Activities (3,682,970) 428,843 1,005 (203,894) (3,457,016) (3,415,955)
Net Increase (Decrease) in Cash and Cash Equivalents (1,386,452) 1,941,687 1,197,110 121,313 1,873,658 (443,441)
Cash and Cash Equivalents, January 1 21,853,794 9,476,152 5,335,984 2,618,889 39,284,819 13,625,042
Cash and Cash Equivalents, December 31 $20,467,342 $11,417,839 $6,533,094 $2,740,202 $41,158,477 $13,181,601
The notes to the financial statements are an integral part of this statement 54
City of Eden Prairie, Minnesota
Proprietary Funds
Statement of Cash Flows
For the Year Ended December 31, 2023 Page 2 of 2
Governmental
Activities -
Internal
Water Wastewater Stormwater Liquor ServiceFundFundFundFundTotalsFund
RECONCILIATION OF OPERATING INCOME
(LOSS) TO NET CASH PROVIDED (USED)
BY OPERATING ACTIVITIES:
Operating Income (Loss)$(1,205,678) $54,886 $649,983 $811,850 $311,041 $208,502 Adjustments to Reconcile Operating Income (Loss)
to Net Cash Provided (Used) by Operating Activities:
Depreciation/Amortization 3,065,370 1,377,115 1,042,310 232,829 5,717,624 1,327,853
(Increase) Decrease in Assets and Deferred Outflows:
Accounts Receivable 6,828 12,415 12,506 (16,630) 15,119 (76,546)
Lease Receivable - - - (8,379) (8,379) (1,874) Special Assessments Receivable (159,855) (120,886) (37,969) - (318,710) -
Due From Other Governments 3,253 50,000 18,241 - 71,494 (9,452)
Inventory - - - (79,776) (79,776) 16,927
Prepaid Items 7,254 (12,332) 5,250 (562) (390) 8,675
Other Post Employment Benefits (Deferred Outflow)5,086 1,325 345 1,034 7,790 124,785
Pensions (Deferred Outflow)278,634 64,300 64,300 107,167 514,401 - Increase (Decrease) in Liabilities and Deferred Inflows:Accounts Payable (18,378) (12,610) 32,597 (16,064) (14,455) 496,394
Salaries Payable 1,532 667 (20) 8,254 10,433 2,419
Unearned Revenue - - - 1,407 1,407 (635)
Due to Other Governments 30,855 - - 14,366 45,221 11,040
Other Post Employment Benefits (19,771) (5,148) (1,338) (4,015) (30,272) (484,523)
Net Pension Liability (726,251) (167,596) (167,596) (279,327) (1,340,770) - Other Post Employment Benefits (Deferred Inflow)13,980 3,641 947 2,840 21,408 342,645
Pensions (Deferred Inflow)533,236 123,054 123,054 205,091 984,435 -
Compensated Absences 17,115 9,949 4,600 26,433 58,097 77,959
Net Cash Provided (Used) by Operating Activities $1,833,210 $1,378,780 $1,747,210 $1,006,518 $5,965,718 $2,044,169
Noncash Investing, Capital and Financing Activities:
Contributions of Capital Assets from Governmental Activities $61,864 $70,118 $653,581 $- $785,563 $360,806
Contributions of Capital Assets from Developers 190,738 213,462 276,038 - 680,238 - Amortization of Bond Premium 52,569 - - - 52,569 -
The notes to the financial statements are an integral part of this statement 55
City of Eden Prairie, Minnesota
Fiduciary Funds
Statement of Fiduciary Net Position
December 31, 2023
Custodial
Funds
Total
ASSETS
Cash and Investments $643,043
Due from Other Governments 98,894
Prepaids 66,142
Total Assets $808,079
LIABILITIES
Accounts Payable $98,359
Due to Other Governments 4,421
Total Liabilities $102,780
NET POSITION
Restricted $705,299
$705,299
The notes to the financial statements are an integral part of this statement
56
City of Eden Prairie, Minnesota
Fiduciary Funds
Statement of Changes in Fiduciary Net Position
For the Year Ended December 31, 2023
Custodial
Funds
Total
ADDITIONS
Grants $379,335
Memberships 492,050
Investments Earnings 32,086
Building Permits 656,040
Other 12,892
Total Additions 1,572,403
DEDUCTIONS
Personnel Services 427,437
Supplies 27,778
Contractual Services 1,081,094
Total Deductions 1,536,309
Net Increase (Decrease) in Fiduciary Net Position 36,094
Net Position - Beginning 669,205
Net Position - Ending $705,299
The notes to the financial statements are an integral part of this statement
57
This page is intentionally left blank
58
NOTES TO FINANCIAL
STATEMENTS
59
City of Eden Prairie, Minnesota
Notes to Financial Statements
Note 1—Summary of Significant Accounting Policies
Reporting Entity
The City of Eden Prairie is a municipal corporation governed by an elected mayor and four-
member council. The accompanying financial statements consist of the primary government and
organizations for which the primary government is financially accountable. In addition, the
primary government may determine through exercise of management’s professional judgment
that the inclusion of an organization that does not meet the financial accountability criteria is
necessary in order to prevent the financial statements from being misleading. The criteria used to
determine if the primary government is financially accountable for a potential component unit
include whether or not the primary government appoints the voting majority of the potential
component unit’s board, is able to impose its will on the potential component unit, is in a
relationship of financial benefit or burden with the potential component unit or is fiscally
depended upon by the potential component unit.
Blended Component Unit
The Housing and Redevelopment Authority ሺH.R.A.ሻ is a body organized and existing under the
laws of the State of Minnesota. The Authority was established in 1980 by the City to carry out
certain redevelopment projects within the City and is governed by the City Council and the Mayor.
The City also has an operational responsibility for the H.R.A. The H.R.A. has a December 31 year-
end and does not issue financial statements. This unit is included within the H.R.A. and Economic
Development funds.
Government-Wide and Fund Financial Statements
The government-wide financial statements ሺi.e., the Statement of Net Position and the Statement
of Activitiesሻ report information on all of the nonfiduciary activities of the City. The fiduciary funds
are only reported in the statement of fiduciary net position and the statement of changes in
fiduciary net position at the fund financial statement level. Governmental activities, which
normally are supported by taxes and intergovernmental revenues, are reported separately from
business-type activities, which rely to a significant extent on fees and charges for support.
The statement of activities demonstrates the degree to which the direct expenses of a given
function or segment are offset by program revenues. Direct expenses are those that are clearly
identifiable with a specific function or segment. Program revenues include 1ሻ charges to
customers or applicants who purchase, use or directly benefit from goods, service or privileges
provided by a given function or segment and 2ሻ grants and contributions that are restricted to
meeting the operational or capital requirements of a particular function or segment. Taxes and
other items not properly included among program revenues are reported instead as general
revenues.
Measurement Focus, Basis of Accounting and Statement Presentation
Separate financial statements are provided for governmental funds, proprietary funds, and
fiduciary funds, even though the latter are excluded from the government-wide financial
statements. Major individual governmental funds and major individual proprietary funds are
reported as separate columns in the fund financial statements.
60
City of Eden Prairie, Minnesota
Notes to Financial Statements
The financial statements for the government-wide, proprietary funds, fiduciary funds ሺwhich
include custodial fundsሻ are reported using the economic resources measurement focus and the
accrual basis of accounting. Revenues are recorded when earned and expenses are recorded when
a liability is incurred, regardless of the timing of the related cash flows. Property taxes are
recognized as revenues in the year for which they are levied. Grants and similar items are
recognized as revenue as soon as all eligibility requirements imposed by the provider have been
met.
Governmental fund financial statements are reported using the current financial resources
measurement focus and the modified accrual basis of accounting. Revenues are recognized as soon
as they are both measurable and available. Revenues are considered to be available when they are
collectible within the current period or soon enough thereafter to pay liabilities of the current
period. For this purpose, the City considers revenues to be available if they are collected within 60
days of the end of the current fiscal period. Expenditures generally are recorded when a liability is
incurred, as under accrual accounting. However, debt service expenditures, as well as
expenditures related to compensated absences and claims and judgments, are recorded only when
payment is due.
Property taxes, licenses, interest and special assessments are all considered to be susceptible to
accrual and so have been recognized as revenues of the current fiscal period. Grants and similar
items are recognized as revenue as soon as all eligibility requirements imposed by the provider
have been met. All other revenue items are considered to be measurable and available only when
payment is received by the City.
The City reports the following major governmental funds:
The General fund is the City’s primary operating fund. It accounts for the proceeds of
specific revenue sources that are restricted or committed to expenditures for specified
purposes other than debt service and capital projects.
The Public Improvement Construction fund accounts for proceeds of bonds sold and
special assessments collected to finance street, drainage, and lateral utility construction
within the City.
The Capital Improvement Maintenance fund accounts for the accumulation of resources
to be used for capital improvements and maintenance of City property.
The City reports the following major proprietary funds:
The Water fund accounts for the operations of the City water system.
The Wastewater fund accounts for the operations of the City wastewater service.
The Stormwater fund accounts for the operations of the City’s stormwater system.
The Liquor fund accounts for the operations of the City’s three retail liquor stores and
the operations of the City-owned Den Road building which is leased to City liquor
operations and other tenants.
Additionally, the city reports the following fund types:
Internal Service funds are used to account for the financing of goods or services
provided by one department or agency to other departments or agencies of the
61
City of Eden Prairie, Minnesota
Notes to Financial Statements
government and to other government units, on a cost reimbursement basis. Internal
Service funds include Health & Benefits, Dental, Severance, Workers Compensation,
Property Insurance, Facilities, Fleet, and Information Technology.
Fiduciary funds include Custodial funds that account for evidence held by the Police
department in the Escrow fund, WAFTA, Metropolitan Council Environmental Services
funds ሺMCESሻ, Fencing and the 494 Corridor Commission.
As a general rule the effect of interfund activity has been eliminated from the government-wide
financial statements. Exceptions to this rule are payments in-lieu of taxes and other charges
between the City’s water, wastewater, and storm water function and various other functions of the
City. Elimination of these charges would distort the direct costs and program revenues reported
from the various functions concerned.
Proprietary funds distinguish operating revenues and expenses from nonoperating items.
Operating revenues and expenses generally result from providing services and producing and
delivering goods in connection with a proprietary fund’s principal ongoing operations. The
principal operating revenue of the City’s proprietary funds are charges to customers for sales and
services. Operating expenses for proprietary funds include the cost of sales and services,
administrative expenses, and depreciation on capital assets. All revenues and expenses not
meeting this definition are reported as nonoperating revenues and expenses.
Assets, Liabilities, Deferred Outflows/Inflows of Resources, and Net Position/Fund Balance
Cash and Investments
Cash and investments, except for small amounts of cash on hand, are deposited in pooled accounts
of the City. The City invests cash surpluses in these accounts; and investment earnings, as well as
gains and losses on sales of securities, are allocated to the various funds on the basis of average
cash balances. Funds with deficit cash balance averages ሺinterfund payableሻ are charged interest
equivalent to the average investment earnings lost in financing the deficits. For purposes of the
statement of cash flows, the Proprietary funds consider all unrestricted investments held in the
pooled accounts of the City to be cash equivalents because this pool is used essentially as a
demand deposit account.
Investments are stated at their fair value as determined by quoted market prices, except for
money market investments and participating interest-earning investment contracts that have a
remaining maturity at time of purchase of one year or less which are recorded at amortized cost,
provided that the fair value of those investments is not significantly affected by the impairment of
the credit standing of the issuer or by other factors. Money market investments are short-term,
highly liquid debt instruments including commercial paper, banker's acceptances, and U.S.
Treasury and agency obligations. Investments in external investment pools that meet the criteria
of GASB Statement No. 79 are valued at amortized costs. If an external investment pool does not
meet the criteria established by this Statement, that pool should apply the provisions in paragraph
16 of Statement No. 31.
62
City of Eden Prairie, Minnesota
Notes to Financial Statements
Interfund Receivables/Payables
Activity between funds that are representative of lending/borrowing arrangements outstanding at
the end of the fiscal year are referred to as “due to/from other funds” ሺi.e., the current portion of
interfund loansሻ or advances to/from other funds. All other outstanding balances between funds
are reported as “due to/from other funds.” Any residual balances outstanding between the
governmental activities and business-type activities are reported in the government-wide
financial statements as “internal balances.”
Inventories and Prepaid Items
Liquor fund inventories are valued at average cost. The Fleet fund’s inventories are valued at cost.
All inventories use the first-in/first-out ሺFIFOሻ method. Inventories and prepaids of governmental
funds are recorded as expenditures when consumed rather than when purchased. Certain
payments to vendors reflect costs applicable to future accounting periods and are recorded as
prepaid items in both government-wide and fund financial statements.
Capital Assets
Capital assets, which include property, plant, equipment, and infrastructure assets ሺe.g., roads,
bridges, sidewalks, and similar itemsሻ, are reported in the applicable governmental or business-
type activities columns in the government-wide financial statements. Capital assets are defined by
the City as assets with an initial individual cost of more than $25,000 and an estimated useful life
in excess of 1 year. Such assets are recorded at historical cost or estimated historical cost if
purchased or constructed. Donated capital assets are recorded at acquisition value at the date of
donation. Lease assets and information technology subscription assets are recorded based on the
measurement of payments applicable to the lease and subscription term.
The costs of normal maintenance and repairs that do not add to the value of the asset or materially
extend assets lives are not capitalized.
The City has chosen to use the modified approach for its infrastructure assets which means the
following criteria will take place:
The City will preserve and maintain infrastructure assets at a condition level of 70.
The Engineering department will be in charge of determining the appropriate condition
level at which these assets are to be maintained.
The City will maintain an inventory of these assets and perform a condition assessment
every 3 years to establish that the condition level of 70 is being maintained.
The City will make annual estimates of the amounts that must be expended to preserve and
maintain these assets at the condition level of 70.
63
City of Eden Prairie, Minnesota
Notes to Financial Statements
Property, plant, and equipment, except for infrastructure, of the City are depreciated or amortized
using the straight-line method over the following estimated useful lives:
Buildings 5-50 years
Land improvements 10-50 years
Leasehold improvements 10-25 years
Lease Assets shorter of useful life or lease term
Subscription Assets shorter of useful life or subscription term
Equipment 5-30 years
Autos 5-20 years
Other assets 5-30 years
Distribution system 25-50 years
Intangible assets 3 years
Deferred Outflows/Inflows of Resources
In addition to assets, the statement of financial position includes a separate section for deferred
outflows of resources. This separate financial statement element, deferred outflows of resources,
represents a consumption of net assets that applies to a future periodሺsሻ and will not be
recognized as an outflow of resources ሺexpense/ expenditureሻ until then. The City has three items
that qualify for reporting in this category. It is the deferred charge on refunding reported in the
government-wide statement of net position, and deferred amounts related to pension and OPEB.
The deferred charge on refunding resulted from the difference between the carrying value of
refunded debt and its reacquisition price. This amount is deferred and amortized over the shorter
of the life of the refunded or refunding debt. The deferred amounts related to pension and OPEB
relate differences between estimated and actual investment earnings, changes in actuarial
assumptions, and other pension and OPEB related changes.
In addition to liabilities, the statement of financial position includes a separate section for
deferred inflows of resources. Deferred inflows of resources represent an acquisition of net assets
that applies to a future periodሺsሻ and so will not be recognized as an inflow of resources ሺrevenueሻ
until that time. The City has three items that qualify for reporting in this category. Unavailable
revenue is reported only in the governmental funds balance sheet. The governmental funds report
unavailable revenues from four sources: property taxes, special assessments, state shared taxes
and loans/invoices not collected within 60 days. The City also reports deferred amounts related to
leases. These amounts are deferred and recognized as an inflow of resources in the period that the
amounts become available. In the government-wide financial statements the City reports deferred
amounts related to leases and deferred amounts related to pension and OPEB.
Pensions
For purposes of measuring the net pension liability, deferred outflows/inflows of resources, and
pension expense, information about the fiduciary net position of the Public Employees Retirement
Association ሺPERAሻ and the relief association and additions to/deductions from PERA’s and the
relief association fiduciary net position have been determined on the same basis as they are
reported by PERA and the relief association except that PERA’s fiscal year end is June 30. For this
64
City of Eden Prairie, Minnesota
Notes to Financial Statements
purpose, plan contributions are recognized as of employer payroll paid dates and benefit
payments and refunds are recognized when due and payable in accordance with the benefit terms.
Investments are reported at fair value. For the governmental activities, the net pension liability
will be liquidated through the General fund.
For purposes of measuring the liability, deferred outflows of resources and deferred inflows of
resources, and expense associated with the City’s requirement to contribute to the Eden Prairie
Firefighter Relief Association, information about the Plan’s fiduciary net position and additions
to/deductions from the Eden Prairie Firefighter Relief Association Plan’s fiduciary net position
have been determined on the same basis as they are reported by the Plan. For this purpose,
benefit payments ሺincluding refunds of contributionsሻ are recognized when due and payable in
accordance with the benefit terms. Investments are reported at fair value.
Postemployment Benefits Other Than Pensions ሺOPEBሻ
For purposes of measuring the total OPEB liability, deferred outflows/inflows of resources related
to OPEB, and OPEB expense, the City recognizes benefit payments when due and payable in
accordance with the benefit terms. The City’s benefit payments consist of the implicit rate subsidy,
and subsidized premiums for officers injured in the line of duty. Other post-employment benefits
are generally liquidated through the Health and Benefits Internal Service funds.
Compensated Absences
The City compensates employees upon termination for unused paid time off ሺPTOሻ. Such pay will
be reflected as a liability in the government-wide financial statement and accrued as an expense as
it is earned in an internal service fund.
General Property Taxes
Property tax levies are set by the City Council in December each year and are certified to Hennepin
County for collection in the following year. In Minnesota, counties act as collection agents for all
property taxes.
The County spreads all levies over taxable property. Such taxes become a lien on January 1 and are
recorded as receivables by the City at that date. Revenues are accrued and recognized in the year
collectible, net of delinquencies.
Real property taxes may be paid by taxpayers in two equal installments on May 15 and October
15. Personal property taxes may be paid on February 28 and June 30. The County provides tax
settlements to taxing districts in February, June, and December.
In the governmental fund financial statements, taxes that remain unpaid at December 31 are
classified as delinquent taxes receivable and are fully offset by unavailable revenue because they
are not available to finance current expenditures.
Special Assessment Levies
Special assessments represent the financing for public improvements paid for by the benefiting
property owner. In the fund financial statements, special assessment revenue and related interest
65
City of Eden Prairie, Minnesota
Notes to Financial Statements
income is generally recognized in the year collected. Hennepin County acts as the billing and
collection agent. Amounts collected by the County during the year that have not yet been remitted
to the City are considered collections for purposes of revenue recognition.
Deferred special assessments receivable represents principal amounts due in future years. Special
deferred assessments receivable includes Green Acres, disability, senior citizen owned property or
other qualified hardship properties. These special assessments are deferred until such time the
property loses its exempt status. While these taxes remain a valid receivable, the timing of their
collection is uncertain. Interest accrues from the year of the deferment.
Delinquent special assessments receivable represents special assessments principal and interest
that are past due. In the governmental fund financial statements, deferred and delinquent special
assessments receivable are fully offset by deferred inflows of resources because such assessment
revenue is not available currently.
Long-term Obligations
In the government-wide financial statements and proprietary fund financial statements, long-term
debt and other long-term obligations are reported as liabilities in the statement of net position.
Bond premiums and discounts are amortized over the life of the bonds using the effective interest
method. Bonds payable are reported net of the applicable bond premium or discount.
In the fund financial statements, governmental fund types recognize bond premiums and
discounts, as well as bond issuance costs, during the current period. The face amount of debt
issued is reported as other financing sources. Premiums and discounts on debt issuances are
reported as other financing sources/uses. Issuance costs, whether or not withheld from the actual
debt proceeds received, are reported as debt service expenditures.
Fund Balance Classifications
In the fund financial statements, governmental funds report fund balance in classifications that
disclose constraints for which amounts in those funds can be spent. These classifications are as
follows:
Nonspendable-consists of amounts that are not in spendable form, such as prepaid assets
and assets that are legally or contractually required to be maintained intact.
Restricted-consists of amounts related to externally imposed constraints established by
creditors, grantors or contributors; or constraints imposed by state statutory provisions.
Committed-consists of internally imposed constraints. These constraints are established by
Resolution of the City Council. Only the Council can remove or change the constraints
placed on committed fund balances by resolution.
Assigned-consists of internally imposed constraints. These constraints reflect the specific
purpose for which it is the City’s intended use. These constraints are established by the City
council and/or management. Pursuant to City Council Resolution, the City Manager or
Finance Manager is authorized to establish assignments of fund balance.
Unassigned-is the residual classification for the general fund and also reflects negative
residual amounts in other funds.
66
City of Eden Prairie, Minnesota
Notes to Financial Statements
When both restricted and unrestricted resources are available for use, it is the City’s policy to first
use restricted resources, and then use unrestricted resources as they are needed. When
unrestricted resources are available for use, it is the City’s policy to use resources in the following
order: 1ሻ committed 2ሻ assigned 3ሻ unassigned.
The City’s fund balance policy requires the unassigned for working capital fund balance
component to equal 50% of the next year’s budgeted tax revenue. In recognition that the
amount for working capital only covers operating costs for the first six months of the year,
the City will maintain an unassigned fund balance component for budget stabilization
which is 10% of the next year’s budget in fund balance for budget stabilization and 5% of
the next year’s budget for budget balancing in the general fund. If the balance falls below
15%, a plan would be developed and implemented to replenish the fund.
Prior Period Comparative Financial Information/Reclassification
The financial statements include certain prior year partial comparative information but not at the
level of detail required for a presentation in conformity with accounting principles generally
accepted in the United States of America. Accordingly, such information should be read in
conjunction with the City’s financial statements for the year ended December 31, 2022, from
which the summarized information was derived. Also, certain amounts presented in the prior
year data have been reclassified in order to be consistent with the current year’s presentation.
Change in Accounting Principle
For the year ended December 31, 2023, the City implemented GASB statement 96, Subscription-
Based Information Technology Arrangements ሺSBITAsሻ. This statement establishes standards of
accounting for SBITAs. SBITAs provide governments with access to vendors’ IT software for
subscription payments without granting perpetual licenses or title to the software. A government
must recognize a subscription liability and right to use subscription asset. The implementation of
this standard resulted in an adjustment of capital assets and long-term liabilities.
Note 2—Stewardship, Compliance and Accountability
Budgetary Information
An annual budget is adopted on a basis consistent with generally accepted accounting principles
for the General fund. The City does not budget for governmental funds other than the General
fund. All annual appropriations lapse at fiscal year end.
The proposed budget is presented to the City Council for review. The Council then holds a truth-
in-taxation meeting after which a final General Fund annual budget is legally adopted by no later
than December 31.
The appropriated budget is prepared by department and division. The City’s directors and division
managers may make transfers of appropriations within a division. Transfers of appropriations
between departments require the approval of the City Manager. The legal level of budgetary
control is the fund level. Any changes in the total budget of each fund must be approved by a
majority vote of the City Council. During the year, adjustments between the original and final
67
City of Eden Prairie, Minnesota
Notes to Financial Statements
General fund amended budget resulted in an increase of $21,250. Following are changes made to
the original budget during the year:
General fund expenditures equal $53,401,278 or 98.1% of the annual amount budgeted of
$54,443,657. All departments have spent less than 100% of the amounts budgeted.
Deficit Fund Equity
The following governmental funds had deficit fund balance/net position at December 31, 2023:
The fund balance deficits of these individual Capital Project funds will be financed by municipal
state aid, special assessments and other future City planned funding as identified in the City’s
Capital Improvement Plan. The fund balance deficit of the Severance and Workers Compensation
Internal Service funds will be financed by user charges. The fund balance deficit of the Health and
Benefits fund is due to the OPEB liability which the City will not fund since it pertains only to the
Implicit Rate.
Note 3—Cash and Investments
Components of Cash and Investments
Cash and investments at year-end consist of the following:
Sustainable Eden Prairie Education & outreach costs for electrification education 21,250$
21,250$
Major Funds:
Public Improvement Construction 517,835$
Non-Major Governmental Funds:
Willow Creek Utilities 45,959
Internal Service Funds:
Health and Benefits 823,167
Severance 907,238
Workers Compensation 293,782
Investments 143,546,118$
Cash on hand 40,711
Total 143,586,829$
68
City of Eden Prairie, Minnesota
Notes to Financial Statements
Cash and investments are presented in the financial statements as follows:
Deposits
In accordance with Minnesota Statutes, the City maintains deposits at those depository banks
authorized by the City Council, including checking accounts and certificates of deposits.
The following is considered the most significant risk associated with deposits:
Custodial Credit Risk
In the case of deposits, this is the risk that in the event of a bank failure, the City’s deposits may be
lost.
Minnesota Statutes require that all deposits be protected by federal deposit insurance, corporate
surety bond, or collateral. The fair value of collateral pledged must equal 110% of the deposits not
covered by federal deposit insurance or corporate surety bonds. Authorized collateral includes
treasury bills, notes, and bonds; issues of U.S. government agencies; general obligation rate “A” or
better; revenue obligations rate “AA” or better; irrevocable standard letters of credit issued by the
Federal Home Loan Bank; and certificated of deposit.
Minnesota Statues require that securities pledged as collateral be held in safekeeping in a
restricted account at the Federal Reserve Bank or in an account at a trust department of a
commercial bank or other financial institution that is not owned or controlled by the financial
institution furnishing the collateral. It is the City’s policy to limit collateral to what is authorized by
Minnesota Statutes.
At year-end, the carrying amount of the City’s deposits was $0 while the balance on the bank
records was $0. At December 31, 2023, all deposits were fully covered by federal depository
insurance, surety bonds, or by collateral held by the City’s agent in the City’s name.
Statement of Net Position
Cash and cash equivalents 142,943,786$
Statement of Fiduciary Net Position
Cash and investments 643,043
143,586,829$
69
City of Eden Prairie, Minnesota
Notes to Financial Statements
Investments
As of December 31, 2023, the city had the following investments and maturities:
* The weighted average life of mortgage-backed securities are no more than seven ሺ7ሻ years from
the date of purchase.
Moody’s Investors Service was used as the primary agency for the municipal bond ratings, in the
case that Moody’s did not provide a rating a Standard & Poor’s was used.
Investments are subject to various risks, the following of which are considered the most
significant.
Interest Rate Risk
Per City policy, the City will match its investments with anticipated cash flow requirements.
Unless matched to a specific cash flow, the City will not directly invest in securities maturing more
than seven ሺ7ሻ years from the date of purchase or for mortgage-backed securities, the weighted
average life must be no more than seven ሺ7ሻ years from the date of purchase. The intent to invest
in securities with longer maturities will be disclosed to the City Council. Currently, the City does
Less 1 to 7
Total Than 1 Year Years*
U.S. Agencies 76,151,649$ 11,555,096$ 64,596,553$
Municipal Bonds 18,853,716 12,949,058 5,904,658
Commercial Paper 990,330 990,330 -
Negotiable Certificate of Deposit 8,892,651 7,435,603 1,457,048
Mutual Funds 38,657,772 38,657,772 -
Total 143,546,118$ 71,587,859$ 71,958,259$
Investment Maturities (in Years)
Negotiable
US Municipal Certificate Commercial Mutual
Agencies Bonds of Deposit Paper Funds Total
Moody's
Aaa 58,895,377$ 7,844,009$ -$ -$ -$ 66,739,386$
Aa1 - 4,460,307 - - - 4,460,307
Aa2 - 1,193,428 - - - 1,193,428
Aa3 - 865,449 - - - 865,449
N/A, N/R 16,121,675 - 8,892,651 990,330 38,657,772 64,662,428
S&P
AA - 797,762 - - - 797,762
AA+1,134,597 808,338 - - - 1,942,935
AAA - 2,884,423 - - - 2,884,423
76,151,649$ 18,853,716$ 8,892,651$ 990,330$ 38,657,772$ 143,546,118$
70
City of Eden Prairie, Minnesota
Notes to Financial Statements
not have any investments with an expected average life greater than seven years from the date of
purchase.
Credit Risk
It is the City’s policy to limit its investments to the following types, which are also authorized by
Minnesota Statutes:
Direct obligations or obligations guaranteed by the United States or its agencies, its
instrumentalities or organizations created by an act of congress, excluding mortgage-
backed securities defined as high risk.
Shares of investment companies registered under the Federal Investment Company Act of
1940 and whose only investments are in securities described above or in general obligation
tax exempt securities or repurchase or reverse repurchase agreements.
Repurchase or reverse repurchase agreements with banks that are members of the Federal
Reserve System with capitalization exceeding $10,000,000: a primary reporting dealer in
U.S. government securities to the Federal Reserve Bank of New York; certain Minnesota
securities broker-dealers, or a bank qualified as a depositor.
Commercial paper issued by United States corporations or their Canadian subsidiaries, of
the higher quality, and maturing in 270 days or less.
Banker’s acceptance of U.S. banks eligible for purchase by the Federal Reserve System.
General obligations of a state or local government.
Money market mutual funds meeting the conditions of rule 2a-7 of the Securities and
Exchange Commission. The fair value of the position in the pool is the net asset value per
share provided by the pool.
Custodial Credit Risk
For an investment, custodial credit risk is the risk that in the event of the failure of the
counterparty, the city will not be able to recover the value of its investments or collateral
securities that are in the possession of an outside party. The City’s investments are held in safe
keeping. The City’s investment policy specifically addresses custodial credit risk by requiring
investments to be held at the Federal Reserve Bank or any bank authorized under the laws of the
United States.
Concentration Risk
This is the risk associated with investing a significant portion of the City’s investment ሺconsidered
5 percent or moreሻ in the securities of a single issuer, excluding U.S. guaranteed investments ሺsuch
as Treasuriesሻ, investment pools, and mutual funds. The City’s investment policy specifically
addresses the City’s desire to limit risk by avoiding over concentration in securities from a specific
issuer and by setting allocation guidelines to diversify the types of securities in the portfolio. At
year end, the City did hold the following investments in securities with a single issuer which
exceeded 5%.
Issuer Percentage
FHLMC 9.0%
71
City of Eden Prairie, Minnesota
Notes to Financial Statements
Fair Value Measurements
The City uses fair value measurements to record fair value adjustments to certain assets and
liabilities and to determine fair value disclosures. The City follows an accounting standard that
defines fair value, establishes a framework for measuring fair value, establishes a fair value
hierarchy based on the quality of inputs used to measure fair value, and requires expanded
disclosures about fair value measurements. In accordance with this standard, the City has
categorized its investments, based on the priority of the inputs to the valuation technique, into a
three-level fair value hierarchy.
The fair value hierarchy gives the highest priority to quoted prices in active markets for identical
assets or liabilities ሺLevel 1ሻ and the lowest priority to unobservable inputs ሺLevel 3ሻ. If the inputs
used to measure the financial instruments fall within different levels of the hierarchy, the
categorization is based on the lowest level input that is significant to the fair value measurement
of the instrument. Financial assets and liabilities recorded on the combined statements of financial
position are categorized based on the inputs to the valuation techniques as follows:
Level 1 – Financial assets and liabilities are valued using inputs that are unadjusted quoted
prices in active markets accessible at the measurement date of identical financial assets
and liabilities.
Level 2 – Financial assets and liabilities are valued based on quoted prices for similar
assets, or inputs that are observable, either directly or indirectly for substantially the full
term through corroboration with observable market data.
Level 3 – Financial assets and liabilities are valued using pricing inputs which are
unobservable for the asset, inputs that reflect the reporting entity’s own assumptions about
the assumptions market participants and would use in pricing the asset.
Level 1 Level 2 Level 3 Total
U.S. Agencies 52,121,556$ 24,030,093$ -$ 76,151,649$
Municipal Bonds - 18,853,716 - 18,853,716
Negotiable Certificates of Deposit - 5,292,987 - 5,292,987
52,121,556$ 48,176,796$ -$ 100,298,352
Investments measured at amortized cost 43,247,766
143,546,118$
72
City of Eden Prairie, Minnesota
Notes to Financial Statements
Note 4—Capital Assets
Capital asset activity for the year ended December 31, 2023 was as follows:
Change in
Accounting
2023 Principle/ 2023
Beginning Prior Period Ending Balance Adjustment Increases Decreases Transfers Balance
GOVERNMENTAL ACTIVITIES
Capital Assets, Not Depreciated/Amortized
Land $ 22,068,182 $ - $ 51,382 $- $- $ 22,119,564
Infrastructure 139,374,845 - 777,837 - 2,975,295 143,127,977
Work in Progress 5,409,234 - 6,456,115 - (5,667,674) 6,197,675
Total Capital Assets, Not Depreciated/Amortized 166,852,261 - 7,285,334 - (2,692,379) 171,445,216
Capital Assets, Depreciated/Amortized
Buildings 74,212,763 - 207,980 82,289 - 74,338,454
Land Improvements 24,788,346 67,723 207,345 62,030 736,565 25,737,949
Leased Equipment 116,896 - - - - 116,896
Subscription Assets - 1,035,865 161,359 - - 1,197,224
Leasehold Improvements 77,318 - - - - 77,318
Machinery and Equipment 5,150,558 589,464 656,265 302,399 (86,207) 6,007,681
Autos 13,286,424 - 861,102 403,240 977,734 14,722,020
Other Assets 11,043,490 291,972 610,074 202,935 278,724 12,021,325
Total Capital Assets, Depreciated/Amortized 128,675,795 1,985,024 2,704,125 1,052,893 1,906,816 134,218,867
Total Capital Assets, Cost 295,528,056 1,985,024 9,989,459 1,052,893 (785,563) 305,664,083
Less Accumulated Depreciation/Amortization for
Buildings 29,298,705 - 2,263,141 71,058 - 31,490,788
Land Improvements 13,358,680 - 1,120,493 62,030 - 14,417,143
Leased Equipment 19,458 - 23,824 - - 43,282
Subscription Assets - - 308,547 - - 308,547
Leasehold Improvements 76,855 - 293 - - 77,148
Machinery and Equipment 4,147,098 - 442,781 302,399 (86,207) 4,201,273
Autos 9,447,593 - 791,950 380,501 86,207 9,945,249
Other Assets 7,120,350 - 658,853 201,933 - 7,577,270
Total Accumulated Depreciation/Amortization 63,468,739 - 5,609,882 1,017,921 - 68,060,700
Total Capital Assets, Depreciated/Amortized, Net 65,207,056 1,985,024 (2,905,757) 34,972 1,906,816 66,158,167
Governmental Activities Capital Assets, Net $ 232,059,317 $ 1,985,024 $ 4,379,577 $ 34,972 $ (785,563) $ 237,603,383
73
City of Eden Prairie, Minnesota
Notes to Financial Statements
2023 2023Beginning Prior Period Ending Balance Adjustment Increases Decreases Transfers Balance
BUSINESS-TYPE ACTIVITIESCapital Assets, Not Depreciated/Amortized
Land $ 1,057,955 $ - $- $- $- $ 1,057,955
Work in Progress 348,360 - 1,648,481 - (414,529) 1,582,312
Total Capital Assets, Not Depreciated/Amortized 1,406,315 - 1,648,481 - (414,529) 2,640,267
Capital Assets, Depreciated/Amortized
Land Improvements 434,190 - 173,325 8,337 - 599,178
Buildings 59,361,370 - - - - 59,361,370
Distribution System 211,619,152 - 852,167 4,632 785,563 213,252,250
Leased Buildings 1,474,097 - - - - 1,474,097
Leasehold Improvements 702,855 - - - - 702,855
Machinery and Equipment 6,170,782 3,520,490 2,025,422 - 414,529 12,131,223
Autos 1,064,820 - - 26,098 - 1,038,722 Other Assets 1,071,425 - - - - 1,071,425
Total Capital Assets, Depreciated/Amortized 281,898,691 3,520,490 3,050,914 39,067 1,200,092 289,631,120
Total Capital Assets, Cost 283,305,006 3,520,490 4,699,395 39,067 785,563 292,271,387
Less Accumulated Depreciation/Amortization for
Land Improvements 161,229 - 27,198 8,337 - 180,090
Buildings 39,772,611 - 1,162,728 - - 40,935,339
Distribution System 127,069,756 - 3,729,689 4,632 - 130,794,813
Leased Buildings 194,808 - 194,808 - - 389,616
Leasehold Improvements 702,855 - - - - 702,855
Machinery and Equipment 3,399,474 - 505,522 - - 3,904,996
Autos 825,900 - 31,536 26,098 - 831,338
Other Assets 108,050 - 66,143 - - 174,193
Total Accumulated Depreciation/Amortization 172,234,683 - 5,717,624 39,067 - 177,913,240
Total Capital Assets, Depreciated/Amortized, Net 109,664,008 3,520,490 (2,666,710) - 1,200,092 111,717,880
Business-Type Activities Capital Assets, Net $ 111,070,323 $ 3,520,490 $ (1,018,229) $- $ 785,563 $ 114,358,147
74
City of Eden Prairie, Minnesota
Notes to Financial Statements
Depreciation/Amortization expense was charged to functions/programs of the City as follows:
Note 5—Long Term Receivables
Non-Current Lease Receivable
The City, as lessor, leases certain real property to several communications companies to install cell
towers, as well as tenants to operate retail businesses, provide education and day care services,
and for a community solar garden under long-term, non-cancellable lease agreements. These
leases expire in various future years with the latest expiration date in 2050. For the year ended
2023, the City received $138,875 in interest revenue and $665,514 in lease revenue per the terms
of these contracts. In addition, the City received variable payments for common area maintenance
and insurance expenses of $93,734 not included in the measurement of the lease receivable.
Notes Receivable
The City has entered into note agreements with Eden Prairie residents to either improve the
quality of housing and/or to increase the availability of affordable housing. These note agreements
are secured by a secured lien that is placed on the property. The Rehabilitation Assistance notes
have a phased repayment plan. If the loan is within 11 years of the loan date, 100% of the
principal amount is due. On the 11th anniversary of the loan origination date, 90% of the loan
principle is due and declines 10% a year until it is forgiven after 20 years. The Home Buyer notes
are interest free and are due either when the home sells or 30 years, whichever occurs first.
The City has also entered into a note agreement with Climatech to help fund planned renovations
through DEED’s Minnesota Investment Fund. The program required the City to apply for the grant
on behalf of Climatech and act as a conduit between DEED and the business. If Climatech meets the
Governmental Activities
Administration $ 260,932
Community Development 52,968
Police 222,541
Fire 549,594
Public Works 346,640
Parks and Recreation 2,849,354
Capital Assets Held by the Government's Internal
Service Funds are Charged to the Various Functions
Based on their Usage of the Assets 1,327,853
Total Depreciation/Amortization Expense $ 5,609,882
Business-Type Activities
Water $ 3,065,370
Wastewater 1,377,115
Stormwater 1,042,310
Liquor 232,829
Total DepreciationAmortization Expense $ 5,717,624
75
City of Eden Prairie, Minnesota
Notes to Financial Statements
job creation and wage commitments, $100,000 of the note principal will be forgiven. The
remaining $270,000 will be repaid over 6 years at an interest rate of 2.0%. The note was paid off
in 2023 and Climatech met their job creation and wage commitments.
The City has entered into a $500,000 TIF note agreement with the developer Elevate for site
improvement costs to redevelop the vacant Ruby Tuesdays and Anchor Bank. The new six-story
building will include 222 apartment units over approximately 13,000 square feet of retail and
restaurants. The note will bear simple interest at the rate of 1% per annum. The interest and
principal shall be paid on the earlier of ሺaሻ the end of the term of the HUD Mortgage ሺ40 yearsሻ or
ሺbሻ a sale, refinancing, or exchange of the Project by the Developer, at which time all principal plus
accrued interest shall be paid in a lump sum.
Receivables as of December 31, 2023, in the aggregate, including the applicable allowances for
uncollectible accounts, are as follows:
Note 6—Interfund Receivables and Payables
The composition of due to/from balances as of December 31, 2023, is as follows:
The funds will be repaid as special assessment revenue, taxes, grants and other future City
planned funding as identified in the City’s Capital Improvement Plan are received.
Interfund payables and receivables are representative of lending/borrowing arrangements to
cover deficit cash balances.
Notes
Project Receivable
Home Buyer Assistance Program 209,064$
Rehabilitation Assistance Program 740,301
Elevate 500,000
Gross Receivables 1,449,365
Less: allowance for uncollectibles (237,341)
Net Total Notes Receivable 1,212,024$
Due From Due To
Other Funds Other Funds
Capital Improvement Maintenance 473,151$ -$
Public Improvement Construction - 473,151
Non-Major Governmental Funds 66,507 66,507
Internal Service Funds 557,359 557,359
Total 1,097,017$ 1,097,017$
76
City of Eden Prairie, Minnesota
Notes to Financial Statements
Note 7—Interfund Transfers
The composition of interfund transfers as of December 31, 2023, is as follows:
Note 8—Pension Plan
Defined Benefit Pension Plans
The Health & Benefits and Enterprise Funds typically liquidate the liability related to the pensions.
Plan Description
The City participates in the following cost-sharing multiple-employer defined benefit pension
plans administered by the Public Employees Retirement Association of Minnesota ሺPERAሻ. PERA’s
defined benefit pension plans are established and administered in accordance with Minnesota
Statutes, Chapters 353 and 356. PERA’s defined benefit pension plans are tax qualified plans
under Section 401ሺaሻ of the Internal Revenue Code.
General Employees Retirement Plan
All full-time and certain part-time employees of the City of Eden Prairie are covered by the General
Employees Plan. General Employees Plan members belong to the Coordinated Plan. Coordinated
Plan members are covered by Social Security.
Public Employees Police and Fire Plan
The Police and Fire Plan, originally established for police officers and firefighters not covered by a
local relief association, now covers all police officers and firefighters hired since 1980. Effective
Transfers In Transfers Out Amount Purpose
General Water 231,831$ Annual budgeted transfer
Wastewater 162,282 Annual budgeted transfer
Stormwater 69,549 Annual budgeted transfer
Non-Major Governmental Funds 1,000 Assist with park program
Capital Improvement Maintenance General 2,661,850 Positive performance
Liquor Fund 800,000 Positive performance
Wastewater 30,000 Assist with capital improvements
Stormwater 338,123 Assist with capital improvements
Public Improvement Construction Water 124,000 Assist with capital improvements
Wastewater 22,200 Assist with capital improvements
Stormwater 470,241 Assist with capital improvements
Non-Major Governmental Funds 824,692 Assist with capital improvements
Non-Major Governmental Funds General 20,000 Assist with Organized Athletics
Capital Improvement Maintenance 450,000 Assist with capital improvements
Water 117,129 Assist with capital improvements
Wastewater 117,129 Assist with capital improvements
Stormwater 51,400 Assist with capital improvements
Non-Major Governmental Funds 4,776,521 Assist with capital improvements
Total of transfers 11,267,947$
77
City of Eden Prairie, Minnesota
Notes to Financial Statements
July 1, 1999, the Police and Fire Plan also covers police officers and firefighters belonging to local
relief associations that elected to merge with and transfer assets and administration to PERA.
Benefits Provided
PERA provides retirement, disability, and death benefits. Benefit provisions are established by
state statute and can only be modified by the state Legislature. Vested, terminated employees who
are entitled to benefits, but are not receiving them yet, are bound by the provisions in effect at the
time they last terminated their public service.
General Employees Plan Benefits
General Employees Plan benefits are based on a member’s highest average salary for any five
successive years of allowable service, age, and years of credit at termination of service. Two
methods are used to compute benefits for PERA's Coordinated Plan members. Members hired
prior to July 1, 1989, receive the higher of Method 1 or Method 2 formulas. Only Method 2 is used
for members hired after June 30, 1989. Under Method 1, the accrual rate for Coordinated
members is 1.2 percent for each of the first 10 years of service and 1.7 percent for each additional
year. Under Method 2, the accrual rate for Coordinated members is 1.7 percent for all years of
service. For members hired prior to July 1, 1989, a full annuity is available when age plus years of
service equal 90 and normal retirement age is 65. For members hired on or after July 1, 1989,
normal retirement age is the age for unreduced Social Security benefits capped at 66.
Benefit increases are provided to benefit recipients each January. The postretirement increase is
equal to 50 percent of the cost-of-living adjustment ሺCOLAሻ announced by the SSA, with a
minimum increase of at least 1 percent and a maximum of 1.5 percent. Recipients that have been
receiving the annuity or benefit for at least a full year as of the June 30 before the effective date of
the increase will receive the full increase. Recipients receiving the annuity or benefit for at least
one month but less than a full year as of the June 30 before the effective date of the increase will
receive a reduced prorated increase. In 2023, legislation repealed the statute delaying increases
for members retiring before full retirement age.
Police and Fire Plan Benefits
Benefits for Police and Fire Plan members first hired after June 30, 2010, but before July 1, 2014,
vest on a prorated basis from 50 percent after five years up to 100 percent after ten years of
credited service. Benefits for Police and Fire Plan members first hired after June 30, 2014, vest on
a prorated basis from 50 percent after ten years up to 100 percent after twenty years of credited
service. The annuity accrual rate is 3 percent of average salary for each year of service. For Police
and Fire Plan members who were first hired prior to July 1, 1989, a full annuity is available when
age plus years of service equal at least 90.
Benefit increases are provided to benefit recipients each January. The postretirement increase is
fixed at 1 percent. Recipients that have been receiving the annuity or benefit for at least 36
months as of the June 30 before the effective date of the increase will receive the full increase.
78
City of Eden Prairie, Minnesota
Notes to Financial Statements
Recipients receiving the annuity or benefit for at least 25 months but less than 36 months as of the
June 30 before the effective date of the increase will receive a reduced prorated increase.
Contributions
Minnesota Statutes Chapter 353 sets the rates for employer and employee contributions.
Contribution rates can only be modified by the state Legislature.
General Employees Plan Contributions
Coordinated Plan members were required to contribute 6.50 percent of their annual covered
salary in fiscal year 2023 and the City was required to contribute 7.50 percent for Coordinated
Plan members. The City’s contributions to the General Employees Fund for the year ended
December 31, 2023, were $1,520,244. The City’s contributions were equal to the required
contributions as set by state statute.
Police and Fire Fund Contributions
Police and Fire Plan members were required to contribute 11.80 percent of their annual covered
salary in fiscal year 2023 and the City was required to contribute 17.70 percent for Police and Fire
Plan members. The City’s contributions to the Police and Fire Fund for the year ended December
31, 2023, were $1,704,781. The City’s contributions were equal to the required contributions as
set by state statute.
Pension Costs
General Employees Fund Pension Costs
At December 31, 2023, the City reported a liability of $13,722,493 for its proportionate share of
the General Employees Fund’s net pension liability. The City’s net pension liability reflected a
reduction due to the State of Minnesota’s contribution of $16 million. The State of Minnesota is
considered a non-employer contributing entity and the state’s contribution meets the definition of
a special funding situation. The State of Minnesota’s proportionate share of the net pension
liability associated with the City totaled $378,334.
The net pension liability was measured as of June 30, 2023, and the total pension liability used to
calculate the net pension liability was determined by an actuarial valuation as of that date. The
City’s proportionate share of the net pension liability was based on the City’s contributions
received by PERA during the measurement period for employer payroll paid dates from July 1,
2022, through June 30, 2023, relative to the total employer contributions received from all of
PERA’s participating employers. The City’s proportionate share was 0.2454 percent at the end of
the measurement period and 0.2438 percent for the beginning of the period.
79
City of Eden Prairie, Minnesota
Notes to Financial Statements
For the year ended December 31, 2023, the City recognized pension expense of $2,180,547 for its
proportionate share of the General Employees Plan’s pension expense. In addition, the City
recognized an additional $1,700 as pension expense ሺand grant revenueሻ for its proportionate
share of the State of Minnesota’s contribution of $16 million to the General Employees Fund.
At December 31, 2023, the City reported its proportionate share of the General Employees Plan’s
deferred outflows of resources and deferred inflows of resources related to pensions from the
following sources:
The $760,122 reported as deferred outflows of resources related to pensions resulting from the
City’s contributions subsequent to the measurement date will be recognized as a reduction of the
net pension liability in the year ended December 31, 2024. Other amounts reported as deferred
outflows and deferred inflows of resources related to pensions will be recognized in pension
expense as follows:
Police and Fire Plan Pension Costs
At December 31, 2023, the City reported a liability of $12,433,464 for its proportionate share of
the Police and Fire Fund’s net pension liability. The net pension liability was measured as of June
30, 2023, and the total pension liability used to calculate the net pension liability was determined
by an actuarial valuation as of that date. The City’s proportionate share of the net pension liability
80
City of Eden Prairie, Minnesota
Notes to Financial Statements
was based on the City’s contributions received by PERA during the measurement period for
employer payroll paid dates from July 1, 2022 through June 30, 2023, relative to the total
employer contributions received from all of PERA’s participating employers. The City’s
proportionate share was 0.7200 percent at the end of the measurement period and 0.7260
percent for the beginning of the period.
The State of Minnesota contributed $18 million to the Police and Fire Fund in the plan fiscal year
ended June 30, 2023. The contribution consisted of $9 million in direct state aid that does meet the
definition of a special funding situation and $9 million in supplemental state aid that does not
meet the definition of a special funding situation. The $9 million direct state was paid on October
1, 2022. Thereafter, by October 1 of each year, the state will pay $9 million to the Police and Fire
Fund until full funding is reached or July 1, 2048, whichever is earlier. The $9 million in
supplemental state aid will continue until the fund is 90 percent funded, or until the State Patrol
Plan ሺadministered by the Minnesota State Retirement Systemሻ is 90 percent funded, whichever
occurs later. The State of Minnesota’s proportionate share of the net pension liability associated
with the City totaled $500,827.
The State of Minnesota is included as a non-employer contributing entity in the Police and Fire
Retirement Plan Schedule of Employer Allocations and Schedule of Pension Amounts by Employer,
Current Reporting Period Only ሺpension allocation schedulesሻ for the $9 million in direct state aid.
Police and Fire Plan employers need to recognize their proportionate share of the State of
Minnesota’s pension expense ሺand grant revenueሻ under GASB 68 special funding situation
accounting and financial reporting requirements. For the year ended June 30, 2023, the City
recognized pension expense of $3,618,134 for its proportionate share of the Police and Fire Plan’s
pension expense. The City recognized $30,164 as grant revenue and pension expense for its
proportionate share of the State of Minnesota’s pension expense for the contribution of $9 million
to the Police and Fire Fund.
The State of Minnesota is not included as a non-employer contributing entity in the Police and Fire
Pension Plan pension allocation schedules for the $9 million in supplemental state aid. The City
recognized $64,799 for the year ended December 31, 2023 as revenue and an offsetting reduction
of net pension liability for its proportionate share of the State of Minnesota’s on-behalf
contributions to the Police and Fire Fund.
City's Proportionate Share of the Net Pension Liability 12,433,464$
State of Minnesota's Proportionate Share of the Net
Pension Liability Associated with the City 500,827
Total 12,934,291$
81
City of Eden Prairie, Minnesota
Notes to Financial Statements
At December 31, 2023, the City reported its proportionate share of the Police and Fire Plan’s
deferred outflows of resources and deferred inflows of resources related to pensions from the
following sources:
The $852,390 reported as deferred outflows of resources related to pensions resulting from the
City’s contributions subsequent to the measurement date will be recognized as a reduction of the
net pension liability in the year ended December 31, 2024. Other amounts reported as deferred
outflows and inflows of resources related to pensions will be recognized in pension expense as
follows:
Long-Term Expected Return on Investment
The State Board of Investment, which manages the investments of PERA, prepares an analysis of
the reasonableness on a regular basis of the long-term expected rate of return using a building-
block method in which best-estimate ranges of expected future rates of return are developed for
each major asset class. These ranges are combined to produce an expected long-term rate of
return by weighting the expected future rates of return by the target asset allocation percentages.
The target allocation and best estimates of geometric real rates of return for each major asset class
are summarized in the following table:
Asset Class Target Allocation Long-Term Expected Real
Rate of Return
Domestic Equity 33.5% 5.10%
International Equity 16.5% 5.30%
Fixed Income 25.0% 0.75%
Private Markets 25.0% 5.90%
Total 100%
Deferred Outflow
of Resources
Deferred Inflow
of Resources
Differences Between Expected and Actual Economic Experience 3,419,132$ -$
Changes in Actuarial Assumptions 14,325,663 17,482,157
Net Collective Difference Between Projected and Actual Investment Earnings - 329,296
Changes in Proportion 168,805 436,284
Contributions Paid to PERA Subsequent to the Measurement Date 852,390 -
Total 18,765,990$ 18,247,737$
82
City of Eden Prairie, Minnesota
Notes to Financial Statements
Actuarial Methods and Assumptions
The total pension liability in the June 30, 2023, actuarial valuation was determined using an
individual entry-age normal actuarial cost method. The long-term rate of return on pension plan
investments used in the determination of the total liability is 7.0 percent. This assumption is
based on a review of inflation and investments return assumptions from a number of national
investment consulting firms. The review provided a range of return investment return rates
deemed to be reasonable by the actuary. An investment return of 7.0 percent was deemed to be
within that range of reasonableness for financial reporting purposes.
Inflation is assumed to be 2.25 percent for the General Employees Plan and 2.25 percent for the
Police and Fire Plan. Benefit increases after retirement are assumed to be 1.25 percent for the
General Employees Plan, and 1 percent for The Police and Fire Plan.
Salary growth assumptions in the General Employees Plan range in annual increments from 10.25
percent after one year of service to 3.0 percent after 27 years of service. In the Police and Fire
Plan, salary growth assumptions range from 11.75 percent after one year of service to 3.0 percent
after 24 years of service.
Mortality rates for the General Employees Plan are based on the Pub-2010 General Employee
Mortality Table. Mortality rates for the Police and Fire Plan are based on the Pub-2010 Public
Safety Employee Mortality tables. The tables are adjusted slightly to fit PERA’s experience.
Actuarial assumptions for the General Employees Plan are reviewed every four years. The most
recent four-year experience study for the General Employees Plan was completed in 2022. The
assumption changes were adopted by the Board and became effective with the July 1, 2023
actuarial valuation. The most recent four-year experience study for the Police and Fire Plan was
completed in 2020 and was adopted by the Board and became effective with the July 1, 2021
actuarial valuation.
The following changes in actuarial assumptions and plan provisions occurred in 2023:
General Employees Fund
Changes in Actuarial Assumptions:
The investment return assumption and single discount rate were changed from 6.5% to
7.0%.
Changes in Plan Provisions:
An additional one-time direct state aid contribution of $170.1 million will be
contributed to the Plan on October 1, 2023.
83
City of Eden Prairie, Minnesota
Notes to Financial Statements
The vesting period of those hired after June 30, 2010 was changed from five years of
allowable service to three years of allowable service.
The benefit increase delay for early retirements on or after January 1, 2024, was
eliminated.
A one-time, non-compounding benefit increase of 2.5 percent minus the actual 2024
adjustment will be payable in a lump sum for calendar year by March 31, 2024.
Police and Fire Fund
Changes in Actuarial Assumptions:
The investment return assumption was changed from 6.5% to 7.0%.
The single discount rate changed from 5.4% to 7.0%.
Changes in Plan Provisions:
Additional one-time direct state aid contribution of 19.4 million will be contributed to
the Plan on October 1, 2023.
Vesting requirement for new hires after June 30, 2014, was changed from a graded 20-
year vesting schedule to a graded 10-year vesting schedule, with 50 percent vesting
after five years, increasing incrementally to 100 percent after 10 years.
A one-time, non-compounding benefit increase of 3.0 percent will be payable in a lump
sum for calendar year 2024 by March 31, 2024.
Psychological treatment is required effective July 1, 2023, prior to approval for a duty
disability benefit for a psychological condition relating to the members’ occupation.
The total and permanent duty disability benefit was increased, effective July 1, 2023.
Discount Rate
The discount rate for the General Employees Plan used to measure the total pension liability in
2023 was 7.0 percent. The projection of cash flows used to determine the discount rate assumed
that contributions from plan members and employers will be made at rates set in Minnesota
Statutes. Based on these assumptions, the fiduciary net position of the General Employees and
Police and Fire Funds were projected to be available to make all projected future benefit payments
of current plan members. Therefore, the long-term expected rate of return on pension plan
investments was applied to all periods of projected benefit payments to determine the total
pension liability.
Pension Liability Sensitivity
The following presents the City’s proportionate share of the net pension liability for all plans it
participates in, calculated using the discount rate disclosed in the preceding paragraph, as well as
what the City’s proportionate share of the net pension liability would be if it were calculated using
a discount rate one percentage point lower or one percentage point higher than the current
discount rate:
84
City of Eden Prairie, Minnesota
Notes to Financial Statements
Pension Plan Fiduciary Net Position
Detailed information about each pension plan’s fiduciary net position is available in a separately
issued PERA financial report that includes financial statements and required supplementary
information. That report may be obtained on the Internet at www.mnpera.org.
Public Employees Defined Contribution Plan
Five council members are covered by the Defined Contribution Plan, a multiple-employer deferred
compensation plan administered by PERA. The Defined Contribution Plan is a tax qualified plan
under Section 401ሺaሻ of the Internal Revenue Code and all contributions by or on behalf of
employees are tax deferred until time of withdrawal.
Plan benefits depend solely on amounts contributed to the plan plus investment earnings, less
administrative expenses. Minnesota Statutes, Chapter 353D.03, specifies plan provisions,
including the employee and employer contribution rates for those qualified personnel who elect to
participate. An eligible elected official who decides to participate contributes five percent of salary
which is matched by the elected official's employer. For salaried employees contributions must be
a fixed percentage of salary. Employees who are paid for their services may elect to make member
contributions in an amount not to exceed the employer share. Employer and employee
contributions are combined and used to purchase shares in one or more of the seven accounts of
the Minnesota Supplemental Investment Fund. For administering the plan, PERA receives two
percent of employer contributions and twenty-five hundredths of one percent ሺ0.25 percentሻ of
the assets in each member's account annually.
Total contributions made by the City during fiscal year 2023 were:
Employee Employer Employee Employer
3,533$ 3,533$ 5.0% 5.0% 5.0%
Amount % of Covered Payroll Required
Rates
85
City of Eden Prairie, Minnesota
Notes to Financial Statements
Defined Benefit Pension Plans – Volunteer Fire Fighter’s Relief Association
Plan Description
Firefighters of the City of Eden Prairie are members of the Eden Prairie Firefighter Relief
Association. The Association is the administrator of the single-employer defined benefit pension
plan available to firefighters. The plan was established in 1968 and operates under the provisions
of Minnesota Statutes Chapter 69, Chapter 424A, and the Association’s by-laws. As of December
31, 2022, membership includes 95 active participants, 108 retirees and beneficiaries currently
receiving benefits, and 20 terminated employees entitled to but not yet receiving benefits. The
plan issues a stand-alone financial statement.
Benefits Provided
Authority for payment of pension benefits is established in Minnesota Statutes §69.77 and may be
amended only by the Minnesota State Legislature. Each member who is at least 50 years of age,
has separated from active service with the Eden Prairie Fire Department, has served at least 10
years of active service with such department before retirement, and has been a member of the
Association in good standing for at least 10 years prior to such retirement, shall be entitled to
receive a service pension based on the vested amount of service time accrued. Full vesting occurs
at 10 years of service, with no provision for partial vesting. Upon retirement, an irrevocable
election for one of the following two plan options must be made.
Monthly Service Pension – Each eligible member electing this plan is entitled to receive a
monthly service pension calculated by multiplying $56 times each year that member has
been an active firefighter in the Fire Department and member in good standing of the Relief
Association, up to a maximum monthly pension of $1,792.
Lump Sum Service Pension – each eligible member electing this plan is entitled to receive a
one-time lump sum service pension equivalent to the base sum amount of $12,400
multiplied by the total number of years of active service.
A member of the Association who has completed 10 or more years of active service with the Fire
Department and has been an active member in the Association for at least 10 years, but has not
reached age 50, shall have the right to retire from the Fire Department without forfeiting the right
to a service pension. The member shall be entitled to a deferred service pension, and upon
attaining the age of 50, the Association shall, upon application thereof, pay the member’s pension
from the date the application is approved.
A member, who is disabled with a fire service related disability, shall be eligible to collect a
disability benefit. The member shall be eligible to receive the disability benefit immediately upon
approval of the Board of Trustees. The disability benefit amount shall be equal to the service
pension amount in effect on the date of the disability for each year of active service. A member
must apply for and meet all the requirements for disability as defined in the bylaws in order to
receive such benefits. A member currently receiving a disability benefit shall receive all approved
86
City of Eden Prairie, Minnesota
Notes to Financial Statements
increases in the monthly service pension applicable to that member’s number of years of active
firefighting service.
In the event of the death of an active or deferred member of the Association, the surviving spouse,
if any, shall be paid 100% of the lump sum benefit for each year of service. If such member who
has no surviving spouse leaves a surviving child or children, such child or children as a group shall
be paid 100% of the lump sum benefit for each year of active service. If such member has no
spouse and no surviving children but has a designated beneficiary on file, such beneficiary shall be
paid 100% of the lump sum benefit for each year of active service. If such member has no spouse,
no surviving children, and no designated beneficiary, the member’s estate shall be paid 100% of
the lump sum benefit. Such death benefits are payable without regard to minimum or partial
vesting requirements.
If an active member dies before completing one year of active service, the Association shall pay a
death benefit to his or her surviving spouse, surviving children or designated beneficiary on file in
the same order and procedure as describe above of $10,000.
In the event of the death of a retired member of the Association, the surviving spouse, if any, shall
be paid until death or remarriage of the surviving spouse, monthly, two-thirds of the monthly
service pension for each year of active service. If such member leaves a surviving child or children
in the addition to a spouse, such child, or children, in the aggregate, shall be paid, monthly, the
sum of one-third of the monthly service pension. If such member is survived only by a child or
children, such child, or children, in the aggregate, shall be paid, monthly, the sum of 100% of the
monthly service pension for each year of active service.
Minnesota Statutes Section 424A.10 provides for the payment of a supplemental benefit equal to
10% of a regular lump sum distribution up to a maximum of $1,000. The supplemental benefit is
in lieu of state income tax exclusion for lump sum distributions and will no longer be available if
state tax law is modified to exclude lump sum distributions from state income tax. The Association
qualifies for these benefits.
Contributions
Minnesota Statues Chapter 424A.093 specifies minimum support rates required on an annual
basis. The significant actuarial assumptions used to compute the municipal support are the same
as those used to compute the accrued pension liability. The minimum contribution from the City of
Eden Prairie and state aid is determined as follows:
87
City of Eden Prairie, Minnesota
Notes to Financial Statements
The Plan is funded in part by fire state aid and, if necessary, City contributions. The State of
Minnesota distributed to the City $600,218 in fire state aid and $9,000 of supplemental benefit
paid by the City to the Relief Association for the year ended December 31, 2023. Required
employer contributions are calculated annually based on statutory provisions. The City’s
statutorily required contribution to the plan for the year ended December 31, 2023 was $0.
Pension Costs
At December 31, 2023, the City reported $803,054 for the Association’s net pension asset. The net
pension asset was measured as of December 31, 2022, and the total pension asset used to
calculate the net pension asset was determined by an actuarial valuation as of January 1, 2022.
As a result of its requirement to contribute to the Relief Association, the City recognized fire
pension expense of ሺ$435,124ሻ for the year ended December 31, 2023. At December 31, 2023, the
City reported deferred outflows of resources and deferred inflows of resources from the following
sources:
The City contributions to the Association subsequent to the measurement date of $600,218,
reported as deferred outflows of resources, will be recognized as an addition of the net pension
asset in the year ended December 31, 2024. Other amounts reported as deferred outflows and
inflows of resources related to the Association’s pension will be recognized in pension expense as
follows:
Deferred
Outflow of
Resources
Deferred
Inflow of
Resources
Liability Gains -$ 182,310$
Changes in Actuarial Assumptions - 47,542
Investment Losses 2,502,451 -
City Contributions Subsequent to the Measurement Date 600,218 -
Total 3,102,669$ 229,852$
Year Ended Dec 31: Pension Expense Amount
2024 (229,816)$
2025 546,033
2026 884,570
2027 1,071,812
2,272,599$
88
City of Eden Prairie, Minnesota
Notes to Financial Statements
Actuarial Assumptions
The actuarial total pension liability was determined as of December 31, 2021, using the following
actuarial assumptions, applied to all periods included in the measurement:
The long-term expected rate of return on pension plan investments was determined using a
building-block method in which best-estimates of expected future real rates of return ሺexpected
returns, net of pension plan investment expense and inflationሻ are developed for each major asset
class. These asset class estimates are combined to produce the portfolio long-term expected rate
of return by weighting the expected future real rates of return by weighting the expected future
real rates of return by the current asset allocation percentage ሺor target allocation, if availableሻ
and by adding expected inflation.
Best estimates of geometric real and nominal rates of return for each major asset class included in
the pension plan's asset allocation are summarized in the following table:
Valuation Date 1/1/22
Actuarial Cost Method Entry Age Normal
Amortization Method Level Dollar Closed
Actuarial Assumptions:
Discount Rate 5.50%
Investment Rate of Return 5.50%
20-Year Municipal Bond Yield 3.50%
Age of Service Retirement Later of Age 50 or 10 years of service
Mortality Assumed life expectancies were based on the
RP-2014 Generational mortality table projected
with Improvement Scale MP-2021
Disability Rate as a percent by age:
Age 20: 0.08%
Age 30: 0.08%
Age 40: 0.20%
Age 50: 0.49%
Age 55: 0.89%
25% of active disabilities are assumed to be in
the line of duty or fire-service related.
Withdrawal Service 0-4 years: 7%
Service 5-9 years: 5%
Service 10 years: 10%
Percent Married 85%
Age Difference 3 Years
Form of Payment 50% Annuity ሺJ&S if marriedሻ, 50% Lump Sum
89
City of Eden Prairie, Minnesota
Notes to Financial Statements
Discount Rate
The discount rate used to measure the total pension liability was 5.5%. Assets were projected
using expected benefit payments and expected asset returns. Expected benefit payments by year
were discounted using the expected assets return assumption for years in which the assets were
sufficient to pay all benefit payments. Any remaining benefit payments after the trust fund is
exhausted are discounted at the municipal bond rate of return. The equivalent single rate is the
discount rate. Based on those assumptions, the pension plan's fiduciary net position was projected
to be available to make all projected future benefit payments of current plan members.
Pension Liability Sensitivity
The following presents the City of Eden Prairies proportionate share of the net pension liability of
the Association, calculated using the discount rate of 5.50%, as well as what the Association’s net
pension liability would be if it were calculated using a discount rate that is one percentage point
lower ሺ4.50%ሻ or one percentage point higher ሺ6.50%ሻ than the current rate:
Plan’s Fiduciary Net Position
Detailed information about the Plan’s fiduciary’s net position is available in a separately-issued
report. That report may be obtained by writing to Eden Prairie Firefighter’s Association, 14800
Scenic Heights Rd., Eden Prairie, MN 55344 or by calling ሺ952ሻ949-8367.
1% Decrease Selected Discount Rate 1% Increase
Net Pension Liability (Asset) 1,468,711$ (803,054)$ (2,691,393)$
Discount Rate 4.50% 5.50% 6.50%
90
City of Eden Prairie, Minnesota
Notes to Financial Statements
Information about the changes in the Plan’s net pension liability ሺassetሻ is as follows:
2022 2021
Total Pension Liability
Service Cost 473,801$ 507,405$
Interest 1,103,831 1,154,852
Differences Between Expected and Actual Experience - (546,930)
Changes of Assumptions - (142,626)
Changes of Benefit Terms - -
Benefit Payments, Including Member Conribution Refunds (1,739,601) (1,993,913)
Net Change in Total Pension Liability (161,969)$ (1,021,212)$
Total Pension Liability - Beginning 20,465,655$ 21,486,867$
Total Pension Liability - Ending (a)20,303,686$ 20,465,655$
Plan Fiduciary Net Position
Municipal Contributions 32,827$ 34,587$
State Contributions 546,833 516,566
Net Investment Income (3,948,288) 2,293,858
Benefit Payments (1,739,601) (1,993,913)
Administrative Expenses (31,081) (21,360)
Other Changes - -
Net Change in Fiduciary Net Position (5,139,310)$ 829,738$
Fiduciary Net Position - Beginning 26,246,050$ 25,416,312$
Fiduciary Net Position - Ending (b)21,106,740$ 26,246,050$
Association's Net Pension Liability/(Asset) - Ending (a) - (b)(803,054)$ (5,780,395)$
General
Employees Plan Police and Fire Fire Relief Total
Pension Expense $ 2,180,547 $ 3,618,134 $ 435,124 $ 6,233,805
Net Pension Asset - - 803,054 803,054
Net Pension Liability 13,722,493 12,433,464 - 26,155,957
Deferred Outflows 3,564,498 18,765,990 3,102,669 25,433,157
Deferred Inflows 4,425,336 18,247,737 229,852 22,902,925
91
City of Eden Prairie, Minnesota
Notes to Financial Statements
Note 9—Other Post-Employment Benefits Plan
Plan Description
The City's single-employer defined benefit OPEB plan provides OPEB for all permanent full-time
employees of the City. The City’s OPEB Plan is administered by the City. The City does not
administer a trust and therefore does not issue a separate report.
Benefits Provided
All retirees of the City have the option under state law to continue their medical insurance
coverage through the City from the time of retirement until the employee reaches the age of
eligibility for Medicare.
For members of all employee groups, the retiree must pay the full premium to continue coverage
for medical and dental insurance.
The City is legally required to include any retirees for whom it provides health insurance coverage
in the same insurance pool as its active employees, whether the premiums are paid by the City or
the retiree. Consequently, participating retirees are considered to receive a secondary benefit
known as an “implicit rate subsidy.” This benefit relates to the assumption that the retiree is
receiving a more favorable premium rate than they would otherwise be able to obtain if
purchasing insurance on their own, due to being included in the same pool with the City’s younger
and statistically healthier active employees.
Employees Covered by Benefit Terms
At January 1, 2023, membership included 20 retirees and others currently receiving benefits, 5
spouses receiving payments and 261 active plan members.
Contributions
All post-employment benefits are based on contractual agreements with employee groups. These
contractual agreements do not include any specific contribution or funding requirements.
Total OPEB Liability
The City's total OPEB liability was measured as of January 1, 2023, and was determined by an
actuarial valuation as of that date. The Health & Benefits and Enterprise Funds typically liquidate
the liability related to OPEB.
Actuarial Assumptions
The total OPEB liability in the January 1, 2022, actuarial valuation was determined using the
following actuarial assumptions, applied to all periods included in the measurement, unless
otherwise specified:
Inflation 2.5%
Salary Increases Service graded table
Healthcare cost trend rates 6.25% as of January 1, 2023 grading to 5.00% over 5 years and
then to 4.00% over the next 48 years
92
City of Eden Prairie, Minnesota
Notes to Financial Statements
Mortality rates were based on the Pub-2010 Public Retirement Plans Headcount-Weighted
Mortality Tables ሺGeneral, Safetyሻ with MP-2021 Generational Improvement Scale.
Discount Rate
The discount rate used to measure the total OPEB liability was 4.0%. Since the plan is not funded
by a trust, the discount rate is equal to the 20-year Municipal Bond Yield.
Changes in the Total OPEB Liability
Sensitivity of the Total OPEB Liability to Changes in the Discount Rate
The following presents the total OPEB liability of the City, as well as what the City's total OPEB
liability would be if it were calculated using a discount rate that is 1% point lower ሺ3.0%ሻ or 1%
point higher ሺ5.0%ሻ than the current discount rate:
Sensitivity of the Total OPEB Liability to Changes in the Healthcare Cost Trend Rates
The following presents the total OPEB liability of the City, as well as what the City's total OPEB
liability would be if it were calculated using healthcare cost trend rates that are 1% point lower
ሺ5.25% decreasing to 4%ሻ or 1% point higher ሺ7.25% decreasing to 6%ሻ than the current
healthcare cost trend rates:
Total OPEB
Liability
Balances at 12/31/22 $ 3,511,989
Changes for the year:
Service Cost 118,766
Interest 70,733
Changes of Assumptions (515,195)
Benefit payments (189,099)
Net changes (514,795)
Balances at 12/31/23 $ 2,997,194
1% Decrease Discount Rate 1% Increase
(3.0)% (4.0)% (5.0)%
Total OPEB Liability 3,263,540$ 2,997,194$ 2,759,189$
1% Decrease
(5.25%
decreasing to
4%)
Healthcare
Cost Trend
Rates (6.25%
decreasing to
5%)
1% Increase
(7.25%
decreasing to
6%)
Total OPEB Liability 2,681,519$ 2,997,194$ 3,369,369$
93
City of Eden Prairie, Minnesota
Notes to Financial Statements
OPEB Expense and Deferred Outflows of Resources and Deferred Inflows of Resources Related to
OPEB
For the year ended December 31, 2023, the City recognized OPEB expense of $164,948. At
December 31, 2023, the City reported deferred outflows and inflows of resources related to OPEB
from the following sources:
The City’s contributions subsequent to the measurement date of $183,115, reported as deferred
outflows of resources, will be recognized as a reduction of the total OPEB liability in the City’s
fiscal year ended December 31, 2024. Other amounts reported as deferred inflows of resources
related to OPEB will be recognized in OPEB expense as follows:
Note 10—Long Term Debt
Bonds
The City issues general obligation bonds to provide funds for the acquisition and construction of
major capital facilities. General obligation bonds have been issued for both governmental and
business-type activities. General obligation bonds are direct obligations and pledge the full faith
and credit of the City.
The City also issues assessment debt with governmental commitment to provide funds for the
construction of streets and utilities. These bonds will be repaid from amounts levied against the
property owners benefited by this construction. In the event that a deficiency exists because of
unpaid or delinquent assessments at the time a debt service payment is due, the City must provide
resources to cover the deficiency until other resources are received. Assessment debt with
governmental commitment has been issued for governmental activities.
The City also issues tax abatement bonds. These bonds and interest thereon are payable from
abatements collected from certain property in the City. If abatement revenues are insufficient to
meet principal and interest due, the City is required to levy ad valorem taxes without limit as to
rate or amount on all taxable property in the City to make up the deficiency.
Deferred
Outflows of
Resources
Deferred
Inflows of
Resources
Contributions Subsequent to the Measurement Date 183,115$ -$
Difference Between Expected and Actual 528,203 104,691
Change in Assumptions 175,058 779,510
Total 886,376$ 884,201$
Year Ended December 31
OPEB
Expense
2024 (24,551)$
2025 (24,551)
2026 (24,551)
2027 (12,992)
20287 (4,530)
Thereafter (89,765)
(180,940)$
94
City of Eden Prairie, Minnesota
Notes to Financial Statements
Bonds currently outstanding ሺin thousands of dollarsሻ are as follows:
2023 Due
Issue Interest Original Amount Within
Date Rates Issue Maturities Outstanding One Year
Governmental Activity
Long-term Liabilities
General Obligation Bonds
G.O. Refunding Bonds 2020A 10/28/20 0.85% 6,081$ 2025 2,455$ 1,216$
Assess Debt With Govt Commit
G.O. Bonds of 2016A 12/29/16 2.30-3.00% 2,360 2032 1,045 225
G.O. Refunding Bonds 2020A 10/28/20 0.85% 1,336 2025 544 273
Tax Abatement Bonds
G.O. Tax Abatement Bonds 2021A 12/08/21 2.00-4.00% 11,940 2035 11,185 830
Total Governmental Activity 15,229 2,544
Unamortized Bond Premiums 1,139
Other Long-term Liabilities
Finance Purchases
Turn out gear 01/12/22 2.32% 381 2027 308 74
Tasers 01/01/20 3.25% 95 2024 18 18
Total Finance Purchases 326 92
Lease Liability 76 24
Subscription Liability 842 258
Compensated Absences 2,455 1,223
Total Long-term Liabilities 20,067$ 4,141$
Business Type Activitiy
Long-term Liabilities
G.O. Bonds of 2016A 12/29/16 2.30-3.00% 1,580 2027 690 165
G.O. Water Bonds 2019A 12/05/19 2.00-3.00% 4,920 2039 4,140 210
G.O. Water Bonds 2021A 12/08/21 2.00-4.00% 5,420 2037 5,165 290
Total Business Type Activity 11,920 9,995 665
Unamortized Bond Premiums 605
Other Long-term Liabilities
Lease Liability 1,151 180
Compensated Absences 439 219
Total Long-term Liabilities 12,190$ 1,064$
95
City of Eden Prairie, Minnesota
Notes to Financial Statements
Annual debt service requirements to maturity for governmental and business-type activity bonds
ሺin thousands of dollarsሻ are as follows:
Years
Ending
12/31 Principal Interest Principal Interest Principal Interest
2024 1,216$ 21$ 498$ 29$ 830$ 347$
2025 1,239 11 376 22 720 316
2026 - - 105 17 755 286
2027 - - 105 14 775 256
2028 - - 105 12 800 224
2029 - - 100 9 1,135 185
2030 - - 100 7 955 144
2031 - - 100 4 995 110
2032 - - 100 1 1,025 79
2033 - - - - 1,050 53
2034 - - - - 1,060 32
2035 - - - - 1,085 11
Total 2,455$ 32$ 1,589$ 115$ 11,185$ 2,043$
Tax Abatement Bonds
Governmental
Assessment
Debt with Govt
Commitment
G.O.Bonds Improv Bonds
Years
Ending
12/31 Principal Interest Principal Interest Principal Interest Principal Interest Principal Interest
2024 92$ 8$ 24$ 2$ 258$ 54$ 665$ 272$ 180$ 35$
2025 76 5 24 1 158 39 685 249 188 29
2026 78 4 23 1 116 28 710 226 206 22
2027 80 2 5 1 129 19 735 202 216 15
2028 - - - - 143 10 575 180 207 8
2029 - - - - 38 1 595 159 122 3
2030 - - - - - - 615 137 32 1
2031 - - - - - - 640 117 - -
2032 - - - - - - 660 100 - -
2033 - - - - - - 675 84 - -
2034 - - - - - - 685 70 - -
2035 - - - - - - 700 56 - -
2036 - - - - - - 715 41 - -
2037 - - - - - - 735 26 - -
2038 - - - - - - 300 15 - -
2039 - - - - - - 305 7 - -
Total 326$ 19$ 76$ 5$ 842$ 151$ 9,995$ 1,941$ 1,151$ 113$
Lease LiabilityFinance Purchases Revenue BondsSubscription Liability Lease Liability
Governmental Business Type
96
City of Eden Prairie, Minnesota
Notes to Financial Statements
Finance Purchases From Direct Borrowing
In January 2022, the City entered into a financing agreement for the purchase of turn out gear for
the Fire department. Payment terms have an interest rate of 2.32% and mature in January 2027.
Upon payment in full of the scheduled debt payments, the lessor’s interest in the equipment is
transferred to the City, free and clear of any right or interest of the lessor. The General Fund will
be used to liquidate this liability.
In 2020, the City entered into a financing agreement for the purchase of tasers for the Police
department. Payment terms have an interest rate of 3.25% and mature in 2025. Upon payment in
full of the scheduled debt payments, the lessor’s interest in the equipment is transferred to the
City, free and clear of any right or interest of the lessor. The General Fund will be used to liquidate
this liability.
Lease Liabilities
The City, as lessee, entered into long-term, non-cancellable lease agreements for copy machines
and building space for its municipal liquor stores. The copy machine leases are a five-year term
with the latest expiration in 2027. The liquor building leases are a ten-year term with the latest
expiration in 2030. The interest and discount rate for leases ranges from 3.25% to 3.5%. Variable
payments of $222,887 were made during 2023 for copy machine maintenance and common area
maintenance at municipal liquor stores. These variable payments are not included in the lease
liability.
The total of the City’s lease assets and accumulated amortization are $1,590,993 and $432,898,
respectively, and may be found in Note 4.
Subscription Liabilities
The City entered into long-term, non-cancellable subscription-based technology arrangements for
payroll and time keeping, fleet maintenance, police body cameras, emergency citizen alerts, email
and City website hosting. The subscriptions range from three year to eight-year terms with the
latest expiration date in 2029. The interest and discount rate ranges from 3.25% to 6.5%. Variable
payments of $28,004 were made during 2023 for employee email licenses, payroll, and time
keeping. These variable payments are not included in the subscription liability.
The total of the City’s subscription assets and accumulated amortization are $1,197,224 and
$308,547, respectively, and may be found in Note 4.
97
City of Eden Prairie, Minnesota
Notes to Financial Statements
Changes in Long Term Debt
Long-term debt activity for the year ended December 31, 2023, ሺin thousands of dollarsሻ was as
follows:
For the governmental activities, the finance purchases payable are generally paid with unassigned
fund balances within the General fund.
There are a number of limitations and restrictions contained in the various bond indentures. The
City is in compliance with all significant limitations and restrictions. Call provisions are applicable
to certain general obligation and special assessment bond issues.
Note 11—Risk Financing and Related Insurance Issues
The City is exposed to various risk of loss related to torts; thefts of, damage to and destruction of
assets; errors and omissions; injuries to employees; and natural disasters. In order to protect
against these risks of loss, the City purchases commercial insurance through the League of
Minnesota Cities Insurance Trust, a public entity risk pool, for property insurance and workers
compensation. This pool currently operates as a common risk management and insurance
program for municipal entities. The City pays an annual premium to the League for its insurance
coverage. The League of Minnesota Cities Insurance Trust is self-sustaining through commercial
companies for excess claims. The City is covered through the pool for any claims incurred but
Change in
Beginning Accounting Ending
Balance Principle Additions Reductions Balance
Governmental Activity
G.O. Bonds 3,673$ -$ -$ 1,218$ 2,455$
Assess. Debt With Govt Commitment
Improvement Bonds 2,087 - - 498 1,589
Tax Abatement Bonds 11,940 - - 755 11,185
Issuance Premium/Discount 1,252 - - 113 1,139
Total Bonds 18,952 - - 2,584 16,368
Lease Liability 99 - - 23 76
Subscription Liability - 1,036 162 356 842
Compensated Absences 2,377 - 2,186 2,108 2,455
Finance Purchases 418 - - 92 326
Total 21,846$ 1,036$ 2,348$ 5,163$ 20,067$
Business Type Activity
Revenue Bonds 10,615$ -$ -$ 620$ 9,995$
Issuance Premium/Discount 657 - - 52 605
Total Bonds 11,272 - - 672 10,600
Lease Liability 1,314 - - 163 1,151
Compensated Absences 381 - 370 312 439
Total 12,967$ -$ 370$ 1,147$ 12,190$
98
City of Eden Prairie, Minnesota
Notes to Financial Statements
unreported, however, retains risk for the deductible portion of its insurance policies. The amount
of these deductibles is considered immaterial to the financial statements.
During the year ended December 31, 2023, there were no significant reductions in insurance
coverage from the prior year. Settled claims have not exceeded the City’s commercial coverage in
any of the past three years.
The City uses its Dental Insurance Internal Service Fund to account for and finance its self-insured
risk of loss for an employee dental plan. The dental plan is funded by the City, employee
contributions, and investment earnings. The claims liability is included in the liabilities of the
Dental Insurance Internal Service Fund at December 31, 2023, and is based on the requirement
that a liability for claims be reported if information prior to issuance of the financial statements
indicates that it is probable that a liability has been incurred on the date of the financial
statements and the loss can be reasonably estimated.
Note 12—Contingencies
The City has been named in various legal actions. At the present time, there is no significant
litigation pending that would cause a material effect on the financial statements if unfavorable
rulings would result. While it is not possible to provide any probability of success or estimate of
potential loss in defending any of these legal actions, the City expects to contest the allegations
vigorously and does not believe these actions will have a material effect on the financial
statements.
A potential claim may be asserted against the City arising out of its membership in the Western
Area Firing Training Academy ሺWAFTAሻ. WAFTA is a joint powers entity consisting of 11 member
cities that was formed in 1974 to purchase property to be used and operated as a fire training
facility. In the late 1980’s, WAFTA became aware that the site was contaminated. Since that time,
WAFTA has been working with the Minnesota Pollution Control Agency ሺMPCAሻ and other
responsible parties to address the contamination issues on the site. At this time, there is not an
estimated dollar amount of the cost to remediate the site nor has a claim been asserted against
WAFTA or the City.
2022 2023
Unpaid Claims at Beginning of Year -$ -$
Incurred Claims - 253,472
Premiums and Settlements - (247,124)
Unpaid Claims at End of Year -$ 6,348$
99
City of Eden Prairie, Minnesota
Notes to Financial Statements
Note 13—Contract Commitments
At December 31, 2023, the City had commitments on various capital projects. These commitments
totaled approximately $13,022,803. The breakdown by fund is shown below.
Note 14—Conduit Debt Obligations
To further economic development in the City, the City has issued bonds that provide capital
financing to private-sector entities for the acquisition and construction of industrial and
residential facilities. The properties financed are pledged as collateral, and the bonds are payable
solely from payments received from the private-sector entities on the underlying mortgage or
promissory notes. In addition, no commitments beyond the collateral, the payments from the
private-sector entities, and maintenance of the tax-exempt status of the conduit debt obligation
were extended by the City for any of those bonds. At December 31, 2023 the bonds have an
aggregate outstanding principal amount payable of $19,530,000.
Note 15—Tax Abatements
The City enters into property tax abatement agreements through the use of tax increment
financing districts with local businesses under various Minnesota Statutes. Under these statutes
the City annually abates taxes collected above the districts’ base tax capacity which is established
during adoption of the tax increment district. These agreements are established to foster
economic development and redevelopment through creating jobs, removing blight and providing
affordable housing. The City uses Minnesota Statutes 469.001 to 469.047 and 469.174 to 469.179
ሺThe Tax Increment Actሻ to create these districts.
Fund Total
General 199,340$
Public Improvement Construction 40,439
Capital Improvement Maintenance 1,181,859
Park Improvement 268,624
Pavement Management 145,879
Economic Development 2,019
Transportation 400,557
Water 694,198
Wastewater 1,079,894
Stormwater 390,998
Internal Service 8,618,996
13,022,803$
100
City of Eden Prairie, Minnesota
Notes to Financial Statements
For the fiscal year ended December 31, 2023, the City has one agreement established under
Minnesota Statute 469.001 to 469.047 which resulted in property taxes totaling $242,164 being
abated. The agreement is a pay as you go note to convert substandard property into an office and
retail complex.
For the fiscal year ended December 31, 2023, the City has six agreements established under
Minnesota Statute 469.174 to 469.179 ሺThe Tax Increment Actሻ which resulted in property taxes
totaling $1,960,750 being abated. The following agreements each exceeded 10 percent of the total
amount abated, during the year:
• A pay as you go note to finance the cost of a senior rental housing project that
provides housing in part for persons or families with low to moderate income. The
abatement amount was $601,189.
• A pay as you go note to finance the cost of a rental apartment project that provides
housing in part for persons or families with low to moderate income. The
abatement amount was $377,639.
• A pay as you go note to finance the cost of a senior rental housing project that
provides housing in part for persons or families with low to moderate income. The
abatement amount was $258,597. • A pay as you go note to finance the cost of a rental housing project that provides
housing in part for persons or families with low to moderate income. The
abatement amount was $675,542.
101
City of Eden Prairie, Minnesota
Notes to Financial Statements
Note 16—Fund Balance Classification
At December 31, 2023, a summary of the governmental fund balance classifications are as follows:
Note 17—Prior Period Adjustment
Beginning net positions were restated to reflect a change in accounting policy related to
capitalized assets in aggregate. Assets in aggregate over $50,000 are now capitalized. The net
book value of these assets should have been included in the December 31, 2022 net position. The
restatement of beginning net position as of January 1, 2023 due to this adjustment is shown
below. Governmental activities were adjusted $949,159. Business type activities were adjusted
$3,520,490. Internal service funds were adjusted $162,897 and enterprise funds were adjusted
$3,520,490.
Public Capital Other
Improvement Improvement Govt
General Construction Maintenance Funds Total
Nonspendable:
Prepaid Items 109,576$ -$ 14,600$ 60,923$ 185,099$
Cemetery Perpetual Care - - - 201,349 201,349
Total Nonspendable 109,576 - 14,600 262,272 386,448
Restricted for:
Debt Service - - - 3,146,174 3,146,174
Special Assessments - - - 88,959 88,959
Park Dedication Fees - - - 3,637,363 3,637,363
Franchise Fee - - - 1,380,984 1,380,984
Grants - - - 77,988 77,988
Cemetery - - - 310,288 310,288
Police - - - 309,515 309,515
Recycling - - - 101,036 101,036
Historical and Cultural - - - 11,866 11,866
Tax Increment - - - 3,901,204 3,901,204
- - - 12,965,377 12,965,377
Assigned to:
Capital Projects - - 28,722,769 6,013,870 34,736,639
Improvement Projects - - - 8,778,642 8,778,642
Total Assigned - - 28,722,769 14,792,512 43,515,281
Unassigned:33,607,091 (517,835) - (45,959) 33,043,297
Total Fund Balance 33,716,667$ (517,835)$ 28,737,369$ 27,974,202$ 89,910,403$
Governmental Business Type Internal Service Enterprise
Activities Activities Funds Funds
Net Position as Previously Reported $ 294,171,398 $ 138,409,349 $ 14,241,204 $ 138,811,516
Prior Period Adjustment 949,159 3,520,490 162,897 3,520,490
Net Position as Restated $ 295,120,557 $ 141,929,839 $ 14,404,101 $ 142,332,006
102
REQUIRED
SUPPLEMENTARY
INFORMATION
103
City of Eden Prairie, Minnesota Required Supplemental Information Modified Approach for Infrastructure Assets Condition Rating of the City’s Street System:
Comparison of Needed-to-Actual Maintenance/Preservation:
The condition of road pavement is measured using Good Pointe’s Icon pavement management system. Pavements in the City of Eden Prairie are visually inspected using the Paver-based Pavement Condition Index (PCI) methodology. The methodology is based on a numeric rating system ranging from 100 for a newly surfaced pavement to 0 for a failed pavement. The condition index is used to classify roads in excellent condition (85-100), very good condition (70-84), good condition (55-69), fair condition (40-54), poor condition (25-39), very poor condition (10-24) and failed condition (0-9). It is the City’s policy to maintain an average PCI of 70 percent.
Average
PCI
2022 85.3%
2019 84.4%
2016 76.9%
2013 79.7%
2010 81.1%
2007 82.3%
2023 2022 2021 2020 2019
Budget 4,860,500$ 5,050,500$ 3,735,500$ 2,949,500$ 2,954,500$
Actual 4,755,130 6,008,581 3,562,681 4,154,944 3,154,439
Difference (105,370)$ 958,081$ (172,819)$ 1,205,444$ 199,939$
104
City of Eden Prairie, Minnesota
Required Supplemental Information
Other Post-Employment Benefits Plan Schedule of Changes in the City’s Total OPEB Liability and Related Ratios
Last 10 Fiscal Years
Less than ten years is presented due to information not available. Will add additional years as they become available.
January 1, 2023 January 1, 2022 January 1, 2021
Total OPEB Liability
Service Cost 118,766$ 162,530$ 192,408$
Interest 70,733 64,120 85,767
Changes in Plan - 18,823 -
Difference Between Expected and Actual Experience - 704,273 -
Changes of Assumptions (515,195) (392,033) 166,748
Benefit Payments (189,099) (177,557) (155,238)
Net Change in Total OPEB Liability (514,795) 380,156 289,685
Total OPEB Liability - Beginning 3,511,989 3,131,833 2,842,148
Total OPEB Liability - Ending 2,997,194$ 3,511,989$ 3,131,833$
Total OPEB Liability 2,997,194$ 3,511,989$ 3,131,833$
Covered Employee Payroll 24,873,052$ 24,148,594$ 23,661,024$
City's Total OPEB Liability as a Percentage of the
Covered Employee Payroll 12.05%14.54% 13.24%
Total OPEB Liability January 1, 2020 January 1, 2019 January 1, 2018
Service Cost
Interest 160,108$ 135,751$ 143,922$
Changes in Plan 109,426 94,001 91,272
Difference Between Expected and Actual Experience - 7,200 -
Changes of Assumptions (209,383) - -
Benefit Payments 141,690 (92,512) -
Net Change in Total OPEB Liability (156,962) (118,903) (169,360)
Total OPEB Liability - Beginning 44,879 25,537 65,834
Total OPEB Liability - Ending 2,797,269 2,771,732 2,705,898
2,842,148$ 2,797,269$ 2,771,732$
Total OPEB Liability
2,842,148$ 2,797,269$ 2,771,732$
Covered Employee Payroll
22,916,246$ 22,281,528$ 21,632,551$
City's Total OPEB Liability as a Percentage of the
Covered Employee Payroll
12.40%12.55% 12.81%
105
City of Eden Prairie, M innesota
Required Supplemental Information
Schedule of Proportionate Share of Net Pension Liability
Public Employees General Employees Retirement Fund
Last Ten Years*
Fiscal Year
Ending
Employer's
Proportion
(Percentage) of the
Net Pension Liability
(Asset)
Employer's
Proportionate
Share (Amount)
of the Net
Pension Liability
(Asset) (a)
State's
Proportionate
Share (Amount)
of the Net
Pension
Liability
Associated with
the City (b)
Employer's
Proportionate
Share of the Net
Pension Liability
and the State's
Proportionate
Share of the Net
Pension Liability
Associated with
the City (a+b)
Employer's
Covered
Payroll**
(c)
Employer's
Proportionate Share
of the Net Pension
Liability (Asset) as a
Percentage of its
Covered Payroll
((a+b)/c)
Plan Fiduciary
Net Position as a
Percentage of
the Total
Pension Liability
June 30, 2015 0.2525%13,085,860$ -$ 13,085,860$ 14,836,066$ 88.20%78.2%
June 30, 2016 0.2482%20,152,608 263,262 20,415,870 15,161,268 134.66%68.9%
June 30, 2017 0.2536%16,189,657 203,595 16,393,252 16,339,119 100.33%75.9%
June 30, 2018 0.2419%13,419,620 440,302 13,859,922 16,251,609 85.28%79.5%
June 30, 2019 0.2365%13,075,555 406,316 13,481,871 16,728,911 80.59%80.2%
June 30, 2020 0.2422%14,520,997 447,832 14,968,829 17,272,920 86.66%79.1%
June 30, 2021 0.2450%10,462,598 319,529 10,782,127 17,628,443 61.16%87.0%
June 30, 2022 0.2438%19,309,040 565,976 19,875,016 18,207,196 109.16%76.7%
June 30, 2023 0.2454%13,722,493 378,334 14,100,827 19,475,515 72.40%83.1%
* This schedule is provided prospectively beginning with the fiscal year ended December 31, 2015.
**For purposes of this schedule, covered payroll is defined as "pensionable wages."
106
City of Eden Prairie, Minnesota
Required Supplemental Information
Schedule of Proportionate Share of Net Pension Liability
Public Employees Police and Fire Fund
Last Ten Years*
Fiscal Year
Ending
Employer's
Proportion
(Percentage) of the
Net Pension Liability
(Asset)
Employer's
Proportionate
Share (Amount)
of the Net
Pension Liability
(Asset) (a)
State
Proportionate
Share (Amount)
of the Net
Pension Liability
Associated with
the City
City's
Proportionate
Share of the Net
Pension Liability
and the State's
Proportionate
Share of the Net
Pension Liability
Associated with
the City
Employer's
Covered
Payroll**
(b)
Employer's
Proportionate Share
of the Net Pension
Liability (Asset) as a
Percentage of its
Covered Payroll
(a/b)
Plan Fiduciary
Net Position as
a Percentage of
the Total
Pension Liability
June 30, 2015 0.7770%8,828,538$ N/A 8,828,538$ 7,116,963$ 124.05%86.6%
June 30, 2016 0.7580%30,419,859 N/A 30,419,859 7,302,618 416.56%63.9%
June 30, 2017 0.7510%10,139,393 N/A 10,139,393 7,706,718 131.57%85.4%
June 30, 2018 0.7296%7,776,785 N/A 7,776,785 7,689,360 101.14%88.8%
June 30, 2019 0.7299%7,770,523 N/A 7,770,523 7,702,165 100.89%89.3%
June 30, 2020 0.7225%9,458,299 224,377 9,682,676 8,151,644 116.03%87.2%
June 30, 2021 0.6933%5,289,145 240,567 5,529,712 8,522,492 62.06%93.7%
June 30, 2022 0.7260%31,592,652 1,380,114 32,972,766 8,838,760 357.43%70.5%
June 30, 2023 0.7200%12,433,464 500,827 12,934,291 9,377,957 132.58%86.5%
* This schedule is provided prospectively beginning with the fiscal year ended December 31, 2015.
**For purposes of this schedule, covered payroll is defined as "pensionable wages."
107
City of Eden Prairie, Minnesota
Required Supplemental Information
Schedule of Proportionate Share of Net Pension Liability
Eden Prairie Fire Relief - Last Ten Years*
* This schedule is provided prospectively beginning with the fiscal year ended December 31, 2014.
2022 2021 2020 2019 2018
Total Pension Liability
Ser vi ce Cost 473,801$ 507,405$ 495,029$ 485,127$ 498,110$
I nt er est 1,103,831 1,154,852 1,149,953 1,159,236 1,147,434
Di ffer ences Bet ween Expect ed and Act ual Exper i ence - (546,930) - (27,803) (29,793)
Changes of Assumption - (142,626) - (65,011) 246,754
Changes of Benefi t Ter ms - - - - 338,844
Benefit Payments, Including Member Contribution Refunds (1,739,601) (1,993,913) (1,142,660) (2,326,728) (1,449,720)
Net Change in Total Pension Liability (161,969) (1,021,212) 502,322 (775,179) 751,629
Total Pension Liability - Beginning 20,465,655 21,486,867 20,984,545 21,759,724 21,008,095
Total Pension Liability - Ending (a)20,303,686 20,465,655 21,486,867 20,984,545 21,759,724
Plan Fiduciary Net Position
Municipal Contributions 32,827 34,587 184,172 209,316 523,283
State Contributions 546,833 516,566 494,923 476,219 457,741
Net Investment Income (3,948,288) 2,293,858 2,942,302 3,828,516 (1,274,855)
Benefi t Payment s (1,739,601) (1,993,913) (1,142,660) (2,326,728) (1,449,720)
Administrative Expenses (31,081) (21,360) (29,231) (29,062) (30,772)
Other Changes - - - 680 254
Net Change in Fiduciary Net Position (5,139,310) 829,738 2,449,506 2,158,941 (1,774,069)
Fiduciary Net Position - Beginning 26,246,050 25,416,312 22,966,806 20,807,865 22,581,934
Fiduciary Net Position - Ending (b)21,106,740 26,246,050 25,416,312 22,966,806 20,807,865
Association's Net Pension Liability/(Asset) Ending (a) - (b)(803,054)$ (5,780,395)$ (3,929,445)$ (1,982,261)$ 951,859$
Fiduciary Net Position as a Percentage of the Total Pension Liability (b) / (a)103.96% 128.24% 118.29% 109.45% 95.63%
Covered Payroll N/A N/A N/A N/A
Net Pension Liability/(Asset) as a Percentage of Covered Payroll N/A N/A N/A N/A
2017 2016 2015 2014
Total Pension Liability
Ser vi ce Cost 485,961$ 434,587$ 449,426$ 413,646$
I nt er est 1,123,468 1,151,849 1,104,701 1,083,202
Di ffer ences Bet ween Expect ed and Act ual Exper i ence - (233,976) - -
Changes of Assumption - 935,047 - -
Changes of Benefi t Ter ms - - - -
Benefit Payments, Including Member Contribution Refunds (1,084,111) (1,135,264) (1,270,544) (1,027,216)
Net Change in Total Pension Liability 525,318 1,152,243 283,583 469,632
Total Pension Liability - Beginning 20,482,777 19,330,534 19,046,951 18,577,319
Total Pension Liability - Ending (a)21,008,095 20,482,777 19,330,534 19,046,951
Plan Fiduciary Net Position
Municipal Contributions 387,665 388,664 398,395 488,073
State Contributions 448,846 448,848 437,948 414,343
Net Investment Income 2,776,128 892,090 (393,362) 646,363
Benefi t Payment s (1,084,111) (1,137,136) (1,270,544) (1,027,216)
Administrative Expenses (34,700) (56,576) (26,323) (37,158)
Other Changes 671 4,426 - 81,893
Net Change in Fiduciary Net Position 2,494,499 540,316 (853,886) 566,298
Fiduciary Net Position - Beginning 20,087,435 19,547,119 20,401,005 19,834,707
Fiduciary Net Position - Ending (b)22,581,934 20,087,435 19,547,119 20,401,005
Association's Net Pension Liability/(Asset) Ending (a) - (b)(1,573,839)$ 395,342$ (216,585)$ (1,354,054)$
Fiduciary Net Position as a Percentage of the Total Pension Liability (b) / (a)107.49% 98.07% 101.12% 107.11%
Covered Payroll N/A N/A N/A N/A
Net Pension Liability/(Asset) as a Percentage of Covered Payroll N/A N/A N/A N/A
108
City of Eden Prairie, Minnesota
Required Supplemental Information
Schedule of Contributions
Public Employees General Employees Retirement Fund
Last Ten Years*
Year Ending
Statutorily
Required
Contributions
(a)
Contributions in
Relation to the
Statutorily Required
Contributions (b)
Contribution
Deficiency
(Excess)
(a-b)
Covered
Payroll**(d)
Contributions as a
Percentage of Covered
Payroll (b/d)
December 31, 2015 1,164,110$ 1,164,110$ -$ 15,528,311$ 7.50%
December 31, 2016 1,157,735 1,157,735 - 15,436,692 7.50%
December 31, 2017 1,199,292 1,199,292 - 15,990,664 7.50%
December 31, 2018 1,231,656 1,231,656 - 16,470,531 7.48%
December 31, 2019 1,286,909 1,286,909 - 17,163,209 7.50%
December 31, 2020 1,290,562 1,290,562 - 17,207,493 7.50%
December 31, 2021 1,345,713 1,345,713 - 17,940,189 7.50%
December 31, 2022 1,399,316 1,399,316 - 18,672,879 7.49%
December 31, 2023 1,520,244 1,520,244 - 20,098,678 7.56%
* This schedule is provided prospectively beginning with the fiscal year ended December 31, 2015.
**For purposes of this schedule, covered payroll is defined as "pensionable wages."
109
City of Eden Prairie, Minnesota
Required Supplemental Information
Schedule of Contributions
Public Employees Police and Fire Fund
Last Ten Years*
Year Ending
Statutorily
Required
Contributions
(a)
Contributions
in Relation to
the Statutorily
Required
Contributions
(b)
Contribution
Deficiency
(Excess)
(a-b)
Covered
Payroll**
(d)
Contributions as a
Percentage of
Covered Payroll
(b/d)
December 31, 2015 1,215,450$ 1,215,450$ -$ 7,509,128$ 16.2%
December 31, 2016 1,188,923 1,188,923 - 7,339,334 16.2%
December 31, 2017 1,224,005 1,224,005 - 7,555,723 16.2%
December 31, 2018 1,260,639 1,260,639 - 7,780,987 16.2%
December 31, 2019 1,342,840 1,342,840 - 7,922,043 16.95%
December 31, 2020 1,464,610 1,464,610 - 8,264,270 17.72%
December 31, 2021 1,543,612 1,543,612 - 8,721,153 17.70%
December 31, 2022 1,596,141 1,596,141 - 9,012,516 17.71%
December 31, 2023 1,704,781 1,704,781 - 9,621,206 17.72%
* This schedule is provided prospectively beginning with the fiscal year ended December 31, 2015.
**For purposes of this schedule, covered payroll is defined as "pensionable wages."
110
City of Eden Prairie, Minnesota
Required Supplemental Information
Schedule of Contributions
Eden Prairie Fire Relief
Last Ten Years
2023 2022 2021 2020 2019
Statutorily Required Contribution -$ 2,320$ 68,174$ 184,172 203,986
Contributions in Relation to Statutorily Required Contribution - (2,320) (68,174) (184,172) (203,986)
Contribution Deficiency (Excess)-$ -$ -$ -$ -$
2018 2017 2016 2015 2014
Statutorily Required Contribution 517,955$ 382,336$ 388,664$ 398,395$ 488,073$
Contributions in Relation to Statutorily Required Contribution (517,955) (382,336) (388,664) (393,065) (488,073)
Contribution Deficiency (Excess)-$ -$ -$ 5,330$ -$
111
City of Eden Prairie, Minnesota
Notes to Required Supplemental Information
Notes to Schedules of Changes in Net Pension Liabilities and Related Ratios Other Post-Employment Benefits Plan The City has no assets accumulated in a trust that meets the criteria in GASB 75.0 2023 Changes Changes in Plan Provisions:
• For the year ending December 31,2023: None. Changes in Actuarial Assumptions:
• The discount rate was changed from 2.00% to 4.00%
• The inflation rate was changed from 2.00% to 2.50%. 2022 Changes Changes in Plan Provisions:
• There was a liability loss of $600,259 due to updated census data.
• There was a liability loss of $104,014 due to claims and premiums higher than expected.
• Per a special agreement, one retiree is receiving City paid medical and dental premiums until December 2023 or until they are eligible another employer’s health insurance coverage, whichever comes first. This change increased the liability $18,823. Changes in Actuarial Assumptions:
• The health care trend rates were changed to better anticipate short term and long term medical increases.
• The mortality tables were updated from the Pub-2010 Public Retirement Plans Headcount-Weighted Mortality Tables (General, Safety) with MP-2019 Generational Improvement Scale to the Pub-2010 Public Retirement Plans Headcount-Weighted Mortality Tables (General, Safety) with MP-2021 Generational Improvement Scale.
• The salary increase rates were updated to reflect the latest experience study.
• The retirement and withdrawal rates were updated to reflect the latest experience study.
• The inflation rate was changed from 2.50% to 2.00%.
• The subsidized benefit for one officer injured in the line of duty, who is age 60 as of the valuation date, is expected to end at age 65 instead of age 62.
• The percent of future retirees electing coverage was lowered from 50% to 40%.
• These changes decreased the liability $392,033. 2021 Changes Changes in Actuarial Assumptions:
• The discount rate was changed from 2.90% to 2.00%.
112
City of Eden Prairie, Minnesota
Notes to Required Supplemental Information
2020 Changes Changes in Actuarial Assumptions:
• The health care trend rates, mortality tables, salary increase rates, and subsidy end date of one officer (age 58 as of the valuation date) injured in the line of duty were updated.
• The discount rate was changed from 3.80% to 2.90%. 2019 Changes Changes in Plan Provisions:
• Per a special agreement, one retiree received City paid medical and dental premiums for six months during 2019. Changes in Actuarial Assumptions:
• The discount rate was changed from 3.30% to 3.80%.
General Employees Fund
2023 Changes Changes in Actuarial Assumptions
• The investment return assumption and single discount rate were changed from 6.5 percent to 7.00 percent. Changes in Plan Provisions
• An additional one-time direct state aid contribution of $170.1 million will be contributed to the Plan on October 1, 2023.
• The vesting period of those hired after June 30, 2010, was changed from five years of allowable service to three years of allowable service.
• The benefit increase delay for early retirements on or after January 1, 2024, was eliminated.
• A one-time, non-compounding benefit increase of 2.5 percent minus the actual 2024 adjustment will be payable in a lump sum for calendar year 2024 by March 31, 2024.
2022 Changes Changes in Actuarial Assumptions:
• The mortality improvement scale was changed from Scale MP-2020 to Scale MP-2021.
Changes in Plan Provisions:
• There were no changes in plan provisions since the previous valuation. 2021 Changes Changes in Actuarial Assumptions:
• The investment return and single discount rates were changed from 7.50 percent to 6.50 percent, for financial reporting purposes.
• The mortality improvement scale was changed from Scale MP-2019 to Scale MP-2020.
113
City of Eden Prairie, Minnesota
Notes to Required Supplemental Information Changes in Plan Provisions:
• There were no changes in plan provisions since the previous valuation.
2020 Changes Changes in Actuarial Assumptions:
• The price inflation assumption was decreased from 2.50% to 2.25%.
• The payroll growth assumption was decreased from 3.25% to 3.00%.
• Assumed salary increase rates were changed as recommended in the June 30, 2019 experience study. The net effect is assumed rates that average 0.25% less than previous rates.
• Assumed rates of retirement were changed as recommended in the June 30, 2019 experience study. The changes result in more unreduced (normal) retirements and slightly fewer Rule of 90 and early retirements.
• Assumed rates of termination were changed as recommended in the June 30, 2019 experience study. The new rates are based on service and are generally lower than the previous rates for years 2-5 and slightly higher thereafter.
• Assumed rates of disability were changed as recommended in the June 30, 2019 experience study. The change results in fewer predicted disability retirements for males and females.
• The base mortality table for healthy annuitants and employees was changed from the RP-2014 table to the Pub-2010 General Mortality table, with adjustments. The base mortality table for disabled annuitants was changed from the RP-2014 disabled annuitant mortality table to the PUB-2010 General/Teacher disabled annuitant mortality table, with adjustments.
• The mortality improvement scale was changed from Scale MP-2018 to Scale MP-2019.
• The assumed spouse age difference was changed from two years older for females to one year older.
• The assumed number of married male new retirees electing the 100% Joint & Survivor option changed from 35% to 45%. The assumed number of married female new retirees electing the 100% Joint & Survivor option changed from 15% to 30%. The corresponding number of married new retirees electing the Life annuity option was adjusted accordingly. Changes in Plan Provisions
• Augmentation for current privatized members was reduced to 2.0% for the period July 1, 2020 through December 31, 2023 and 0.0% after. Augmentation was eliminated for privatizations occurring after June 30, 2020.
2019 Changes Changes in Actuarial Assumptions:
• The morality projection scale was changed from MP-2017 to MP-2018. Changes in Plan Provisions:
• The employer supplemental contribution was changed prospectively, decreasing from $31.0 million to $21.0 million per year. The State’s special funding contribution was changed prospectively, requiring $16.0 million due per year through 2031.
114
City of Eden Prairie, Minnesota
Notes to Required Supplemental Information
2018 Changes Changes in Actuarial Assumptions:
• The morality projection scale was changed from MP-2015 to MP-2017.
• The assumed benefit increase was changed from 1.00 percent per year through 2044 and 2.50 percent per year thereafter to 1.25 percent per year. Changes in Plan Provisions:
• The augmentation adjustment in early retirement factors is eliminated over a five-year period starting July 1, 2019, resulting in actuarial equivalence after June 30, 2024.
• Interest credited on member contributions decreased from 4.00 percent to 3.00 percent, beginning July 1, 2018.
• Deferred augmentation was changed to 0.00 percent, effective January 1, 2019. Augmentation that has already accrued for deferred members will still apply.
• Contribution stabilizer provisions were repealed.
• Annual increases were changed from 1.00 percent per year with a provision to increase to 2.50 percent upon attainment of 90.00 percent funding ratio to 50.00 percent of the Social Security Cost of Living Adjustment, not less than 1.00 percent and not more than 1.50 percent, beginning January 1, 2019.
• For retirements on or after January 1, 2024, the first benefit increase is delayed until the retiree reaches normal retirement age; does not apply to Rule of 90 retirees, disability benefit recipients, or survivors.
• Actuarial equivalent factors were updated to reflect revised mortality and interest assumptions. 2017 Changes Changes in Actuarial Assumptions:
• The combined service annuity (CSA) loads were changed from 0.80 percent for active members and 60.00 percent for vested and non-vested deferred members. The revised CSA load are now 0.00 percent for active member liability, 15.00 percent for vested deferred member liability, and 3.00 percent for non-vested deferred member liability.
• The assumed postretirement benefit increase rate was changed for 1.00 percent per year for all years to 1.00 percent per year through 2044 and 2.50 percent per year thereafter. Changes in Plan Provisions:
• The State’s contribution for the Minneapolis Employees Retirement Fund equals $16,000,000 in 2017 and 2018, and $6,000,000 thereafter.
• The Employer Supplemental Contribution for the Minneapolis Employees Retirement Fund changed from $21,000,000 to $31,000,000 in calendar years 2019 to 2031. The state’s contribution changed from $16,000,000 to $6,000,000 in calendar years 2019 to 2031. 2016 Changes Changes in Actuarial Assumptions:
• The assumed postretirement benefit increase rate was changed from 1.00 percent per year through 2035 and 2.50 percent per year thereafter to 1.00 percent per year for all years.
• The assumed investment return was changed from 7.90 percent to 7.50 percent. The single discount rate changed from 7.90 percent to 7.50 percent.
115
City of Eden Prairie, Minnesota
Notes to Required Supplemental Information
• Other assumptions were changed pursuant to the experience study June 30, 2015. The assumed future salary increases, payroll growth, and inflation were decreased by 0.25 percent to 3.25 percent for payroll growth and 2.50 percent for inflation. Changes in Plan Provisions
• There have been no changes since the prior valuation.
2015 Changes: Changes in Actuarial Assumptions:
• The assumed annual increase rate was changed from 1.00 percent per year through 2030 and 2.50 percent per year thereafter to 1.00 percent per year through 2035 and 2.50 percent per year thereafter. Changes in Plan Provisions:
• On January 1, 2015, the Minneapolis Employees Retirement Fund was merged into the General Employees Fund, which increased the total pension liability by $1.1 billion and increase the fiduciary plan net position by $892 million. Upon consolidation, state and employer contributions were revised; the State’s contribution of $6.0 million, which meets the special funding situation definition, was due September 2015.
Police and Fire Fund
2023 Changes Changes in Actuarial Assumptions
• The investment return assumption was changed from 6.5 percent to 7.00 percent.
• The single discount rate changed from 5.4 percent to 7.0 percent. Changes in Plan Provisions
• Additional one-time direct state aid contribution of 19.4 million will be contributed to the Plan on October 1, 2023.
• Vesting requirement for new hires after June 30, 2014, was changed from a graded 20-year vesting schedule to a graded 10-year vesting schedule, with 50 percent vesting after five years, increasing incrementally to 100% after 10 years.
• A one-time, non-compounding benefit increase of 3.0 percent will be payable in a lump sum for calendar year 2024 by March 31, 2024.
• Psychological treatment is required effective July 1, 2023, prior to approval for a duty disability benefit for a psychological condition relating to the member’s occupation.
• The total and permanent duty disability benefit was increased, effective July 1, 2023.
2022 Changes Changes in Actuarial Assumptions:
• The mortality improvement scale was changed from Scale MP-2020 to Scale MP-2021.
• The single discount rate changed from 6.50% to 5.40%.
116
City of Eden Prairie, Minnesota
Notes to Required Supplemental Information Changes in Plan Provisions:
• There were no changes in plan provisions since the previous valuation. 2021 Changes Changes in Actuarial Assumptions:
• The investment return and single discount rates were changed from 7.50 percent to 6.50 percent, for financial reporting purposes.
• The inflation assumption was changed from 2.50 percent to 2.25 percent.
• The payroll growth assumption was changed from 3.25 percent to 3.00 percent.
• The base mortality table for healthy annuitants and employees was changed from the RP-2014 table to the Pub-2010 Public Safety Mortality table. The mortality improvement scale was changed from MP-2019 to MN-2020.
• The base mortality table for disabled annuitants was changed from the RP-2014 healthy annuitant mortality table (with future mortality improvement according to Scale MP-2019) to the Pub-2010 Public Safety disabled annuitant mortality table (with future mortality improvement according to Scale MP-2020).
• Assumed rates of salary increase were modified as recommended in the July 14, 2020 experience study. The overall impact is a decrease in gross salary increase rates.
• Assumed rates of retirement were changed as recommended in the July 14, 2020 experience study. The changes result in slightly more unreduced retirements and fewer assumed early retirements.
• Assumed rates of withdrawal were changed from select and ultimate rates to service-based rates. The changes result in more assumed terminations.
• Assumed rates of disability were increased for ages 25-44 and decreased for ages over 49. Overall, proposed rates result in more projected disabilities.
• Assumed percent married for active female members was changed from 60 percent to 70 percent. Minor changes to form of payment assumptions were applied. Changes in Plan Provisions:
• There were no changes in plan provisions since the previous valuation.
2020 Changes Changes in Actuarial Assumptions
• The morality projection scale was changed from MP-2018 to MP-2019. Changes in Plan Provisions
• There have been no changes since the prior valuation. 2019 Changes Changes in Actuarial Assumptions
• The morality projection scale was changed from MP-2017 to MP-2018. Changes in Plan Provisions
• There have been no changes since the prior valuation.
117
City of Eden Prairie, Minnesota
Notes to Required Supplemental Information
2018 Changes Changes in Actuarial Assumptions
• The morality projection scale was changed from MP-2016 to MP-2017. Changes in Plan Provisions
• Annual increases were changed to 1.00 percent for all years, with no trigger.
• An end date of July 1, 2048 was added to the existing $9.0 million state contribution.
• New annual state aid will equal $4.5 million in fiscal years 2019 and 2020, and $9.0 million thereafter until the plan reaches 100 percent funding, or July 1, 2048, if earlier.
• Member contributions were changed from 10.80 percent to 11.30 percent of pay, effective January 1, 2019 and 11.80 percent of pay, effective January 1, 2020.
• Employer contributions were changed from 16.20 percent to 16.95 percent of pay, effective January 1, 2019 and 17.70 percent of pay, effective January 1, 2020.
• Interest credited on member contributions decreased from 4.00 percent to 3.00 percent, beginning July 1, 2018.
• Deferred augmentation was changed to 0.00 percent, effective January 1, 2019. Augmentation that has already accrued for deferred members will still apply.
• Actuarial equivalent factors were updated to reflect revised mortality and interest assumptions. 2017 Changes Changes in Actuarial Assumptions
• Assumed salary increases were changed as recommended in the June 30, 2016 experience study. The net effect is proposed rates that average 0.34 percent lower than the previous rates.
• Assumed rates of retirement were changed, resulting in fewer retirements.
• The combined service annuity (CSA) load was 30.00 percent for vested and non-vested, deferred members. The CSA has been changed to 33.00 percent for vested members and 2.00 percent for non-vested members.
• The base mortality table for healthy annuitants was changed from the RP-2000 fully generational table to the RP-2014 fully generational table (with a base year of 2006), with male rates adjusted by a factor of 0.96. The mortality improvement scale was changed from Scale AA to Scale MP-2016. The base mortality table for disabled annuitants was changed from the RP-2000 disabled mortality table to the mortality tables assumed for healthy retirees.
• Assumed termination rates were decreased to 3.00 percent for the first three years of service. Rates beyond the select period of three years were adjusted, resulting in more expected terminations overall.
• Assumed percentage of married female members was decreased from 65.00 percent to 60.00 percent.
• Assumed age difference was changed from separate assumptions for male members (wives assumed to be three years younger) and female members (husbands assumed to be four years older) to the assumption that males are two years older than females.
• The assumed percentage of female members electing joint and survivor annuities was increased.
118
City of Eden Prairie, Minnesota
Notes to Required Supplemental Information
• The assumed annual increase rate was changed from 1.00 percent for all years to 1.00 percent per year through 2064 and 2.50 percent thereafter.
• The single discount rate was changed from 5.60 percent per annum to 7.50 percent per annum. Changes in Plan Provisions
• There have been no changes since the prior valuation. 2016 Changes Changes in Actuarial Assumptions
• The assumed postretirement benefit increase rate was changed from 1.00 percent per year through 2037 and 2.50 percent per year thereafter to 1.00 percent per year for all future years.
• The assumed investment return was changed from 7.90 percent to 7.50 percent.
• The single discount rate changed from 7.90 percent to 5.60 percent.
• The assumed future salary increases, payroll growth, and inflation were decreased by 0.25 percent to 3.25 percent for payroll growth and 2.50 percent for inflation. Changes in Plan Provisions
• There have been no changes since the prior valuation. 2015 Changes Changes in Actuarial Assumptions
• The assumed postretirement benefit increase rate was changed from 1.00 percent per year through 2030 and 2.50 percent per year thereafter to 1.00 percent per year through 2037 and 2.50 percent per year thereafter. Changes in Plan Provisions
• The postretirement benefit increase to be paid after the attainment of the 90.00 percent funding threshold was changed from inflation up to 2.50 percent, to a fixed rate of 2.50 percent Fire Relief
2023 Changes
• No changes since 2022 report 2022 Changes
• No changes since 2021 report 2021 Changes
• The mortality projection scale was updated from MP-2019 to MP-2021
• The termination assumption was updated to reflect experience from the last four years
119
City of Eden Prairie, Minnesota
Notes to Required Supplemental Information
2020 Changes
• No changes since 2019 report
2019 Changes
• The mortality projection scale was updated from MP-2017 to MP-2019 2018 Changes
• The lump sum benefit level was increased from $10,000 to $12,400
• The mortality projection scale was updated from MP-2016 to MP-2017
• The termination decrement scale was updated to reflect a recent experience study
• The lump sum election rate was changed from 20% to 50% 2017 Changes
• No changes since 2016 report
2016 Changes
• The base mortality table was updated from the RP-2014 Blue Collar table to the unadjusted RP-2014 table
• The mortality projection scale was updated from MP-2014 to MP-2016
2015 Changes
• No changes since 2014 report which was the year of implementation so no further changes to note.
120
COMBINING FUND
STATEMENTS
121
City of Eden Prairie, Minnesota Nonmajor Governmental Funds Special Revenue Funds Special revenue funds are used to account for and report the proceeds of specific revenue sources that are restricted or committed to expenditures for specified purposes other than debt service or capital projects. Housing Redevelopment Authority (HRA Grant) – This fund accounts for monies received under Title I of the Housing and Community Development Act of 1974 and other related housing activities. Pleasant Hills Cemetery – This fund accounts for the current operations of the City cemetery including maintenance costs and lot sales. Eden Prairie Cemetery – This fund accounts for the current operations of the City cemetery including maintenance costs and lot sales. Grant – This fund accounts for monies received from the State. The grant will fund a police officer who will dedicate his time to decreasing DWI’s. Recycling – This fund accounts for monies received from Hennepin County's household waste rebate programs. All dollars received are to be spent on eligible recycling programs within Eden Prairie. Opioid Settlement – This fund accounts for monies received under the National Opioid Settlement. All dollars received are to be spent to fight the opioid crisis. Historical and Cultural - This fund accumulates revenue from the sale of a book on Eden Prairie's 100-year history and the sale of old street signs. The book was donated to the City by the Eden Prairie Historical Society, with revenues earmarked for expenditure on the preservation of the history of Eden Prairie. Debt Service Funds Debt service funds are used to account for all financial resources that are restricted, committed, or assigned to expenditures for principal and interest. General Obligation Refunding Bonds 2016A – This fund accounts for the refunding of the G.O. Bonds 2008B which accounted for the accumulation of resources needed to repay bonds issued to finance the construction of streets, lateral utilities, and drainage for the Flying Cloud Drive construction project. The primary sources of repayment on these bonds are special assessments levied on benefited properties. General Obligation Improvement Bonds 10A/20A – This fund is used to account for the accumulation of tax revenues needed to repay bonds issued to pay the construction costs for the Singletree Lane project. G.O. Bonds 10A were refunded with G.O. Bonds 20A.
122
City of Eden Prairie, Minnesota Nonmajor Governmental Funds Debt Service Funds (Continued) General Obligation Refunding 11D/20A – This fund accounts for the refunding of the G.O. Improvement Revolving Bonds which accounted for the accumulation of tax revenues needed to repay bonds issued to finance the construction at 212 and Charleston Road. G.O. Bonds 11D were refunded with G.O. Bonds 20A. General Obligation Refunding 12A/20A – This fund accounts for the refunding of the G.O. Bonds 2005C which accounted for the accumulation of tax revenues needed to repay bonds issued to finance construction projects for various trails, park improvements and the community center. G.O. Bonds 12A were refunded with G.O. Bonds 20A. General Obligation Refunding 12B/20A – This fund accounts for the refunding of the G.O. Bonds 2006B which accounted for the accumulation of tax revenues needed to repay bonds issued to finance construction projects for the new fire station. G.O. Bonds 12B were refunded with G.O. Bonds 20A. General Obligation Tax Abatement 2014A/21A – This fund accounts for the accumulation of tax revenues needed to repay bonds issued to finance construction of the aquatics and fitness expansion. G.O. Tax abatement 2014A were refunded with G.O. Tax Abatement Bonds 21A. General Obligation Bonds 2016A – This fund is used to account for the accumulation of special assessments needed to repay bonds issued to finance the West 70th project. Capital Project Funds Capital project funds are used to account for all financial resources that are restricted, committed, or assigned to expenditures for capital outlay. Police - This fund accounts for all confiscated money, and / or property obtained through drug-related criminal arrests and compliance fines. The funds are earmarked for expenditures on law enforcement operations. E-911 - This fund accounts for monies received from the State of Minnesota to be used for the E-911 emergency system. Senior Board/EP Players - This fund was established to account for monies received for Senior Awareness Week and EP Players, a parks and recreation department theater program. Park Improvement - This fund accounts for the park dedication fees, grants, and other contributions earmarked for expenditure on park acquisition and development.
123
City of Eden Prairie, Minnesota Nonmajor Governmental Funds Capital Project Funds (Continued) CIP Trails - This fund accounts for the accumulation of resources to be used for capital improvements and maintenance of City trails. CIP Pavement Management - This fund accounts for the accumulation of resources to be used for capital improvements and maintenance of City streets. Economic Development – This fund accounts for money set aside to assist in the redevelopment of the City. Project – This fund accounts for tax increment revenue set aside to assist in the redevelopment of the City. HRA – This fund accounts for the accumulation of resources to be used for economic development projects. Tree Replacement – This fund accounts for tree replacement fees that are collected from permittees who have demonstrated that it is not possible or reasonable to plant all or some of the required replacement trees on site. The revenue will be used for planting of trees and natural enhancements within the City. Transportation - This fund accounts for proceeds of state aid. This revenue is used to finance street improvements. Shady Oak Road North – This fund accounts for the accumulation of resources to be used for the reconstruction of Shady Oak Road from Rowland Road through the Highway 62 interchange. Cable PEG (Public, Educational, and Government) – This fund accounts for the revenues collected from Comcast. These funds will be used to produce PEG Access programming. Eden Prairie Connect to Flying Cloud – This fund accounts for the accumulation of resources to be used for the construction of road from Frederick Place to north of Riley Creek. Homeowners Improvements Area – This fund accounts for the accumulation of resources to be used for Housing Improvements to the Fairway Woods II Condominiums. Duck Lake Road Construction – This fund accounts for the accumulation of resources to be used to upgrade existing rural roadway to a 2 lane urban roadway. Dell Road – This fund accounts for accumulation of resources to be used to upgrade a rural section of Dell Road between Crestwood Terrace and County Road 61.
124
City of Eden Prairie, Minnesota Nonmajor Governmental Funds Capital Project Funds (Continued) Willow Creek Utilities – This fund accounts for accumulation of resources to be used for street improvements and installation of city utilities in the Willow Creek Road neighborhood. Permanent Funds Permanent funds are used to account for resources that are restricted to the extent that only earnings, and not principal, may be used for purposes that support the City’s programs that is, for the benefit of the City or its citizens. Cemetery Perpetual Care - This fund was established to account for funds dedicated for cemetery maintenance in accordance with state statutes.
125
This page is intentionally left blank
126
Page 1 of 9
City of Eden Prairie, Minnesota
Combining Balance Sheet
Nonmajor Governmental Funds
December 31, 2023
Pleasant Eden
HRA Hill Prairie Grant
Grant Cemetery Cemetery Fund
ASSETS
Cash and Investments $- $141,127 $114,421 $41,245
Receivables
Accounts - 3,061 1,810 - Lease Receivable - - - -
Investment Interest - 865 497 271
Lease Receivable Interest - - - -
Due from Other Governments 39,169 - - 38,477 Unremitted Taxes - - - -
Delinquent Special Assessments - - - -
Deferred Special Assessments - - - -
Special Deferred Special Assessments - - - -
Due from Other Funds - 21,996 - -
Prepaid Items - - - - Lease Receivable - - - -
Land Held for Resale - - - -
Notes Receivable (net of allow for uncollectible)- - - -
Total Assets $39,169 $167,049 $116,728 $79,993
LIABILITIES
Accounts and Contracts Payable $15,148 $2,420 $848 $-
Salaries Payable 2,025 - - 2,005
Investment Interest Payable - - - - Due to Other Governments - - - -
Due to Other Funds 21,996 - - -
Unearned Revenue - 1,150 - -
Total Liabilities 39,169 3,570 848 2,005
DEFERRED INFLOWS OF RESOURCES
Deferred Inflow of Resource Related to Lease Receivable - - - - Unavailable Revenue-Revenue - - 375 -
Unavailable Revenue-Special Assessments - - - -
Total Deferred Inflows of Resources - - 375 -
FUND BALANCES
Nonspendable - - - -
Restricted - 163,479 115,505 77,988
Assigned - - - -
Unassigned - - - - Total Fund Balance - 163,479 115,505 77,988
Total Liabilities, Deferred Inflows of Resources, and Fund Balances $39,169 $167,049 $116,728 $79,993
Special Revenue
127
Page 2 of 9
City of Eden Prairie, Minnesota
Combining Balance Sheet
Nonmajor Governmental Funds
December 31, 2023
ASSETS
Cash and Investments
Receivables
AccountsLease Receivable
Investment Interest
Lease Receivable Interest
Due from Other GovernmentsUnremitted Taxes
Delinquent Special Assessments
Deferred Special Assessments
Special Deferred Special Assessments
Due from Other Funds
Prepaid ItemsLease Receivable
Land Held for Resale
Notes Receivable (net of allow for uncollectible)
Total Assets
LIABILITIES
Accounts and Contracts Payable
Salaries Payable
Investment Interest PayableDue to Other Governments
Due to Other Funds
Unearned Revenue
Total Liabilities
DEFERRED INFLOWS OF RESOURCES
Deferred Inflow of Resource Related to Lease ReceivableUnavailable Revenue-Revenue
Unavailable Revenue-Special Assessments
Total Deferred Inflows of Resources
FUND BALANCES
Nonspendable
Restricted
Assigned
UnassignedTotal Fund Balance
Total Liabilities, Deferred Inflows of Resources, and Fund Balances
Historical
Opioid and
Recycling Settlement Cultural Total
$104,716 $85,152 $14,026 $500,687
- - - 4,871 - - - -
- 459 172 2,264
- - - -
- - - 77,646 - - - -
- - - -
- - - -
- - - -
- - - 21,996
- - - - - - - -
- - - -
- - - -
$104,716 $85,611 $14,198 $607,464
$2,882 $- $2,263 $23,561
798 - - 4,828
- - - - - - 69 69
- - - 21,996
- - - 1,150
3,680 - 2,332 51,604
- - - - - - - 375
- - - -
- - - 375
- - - -
101,036 85,611 11,866 555,485
- - - -
- - - - 101,036 85,611 11,866 555,485
$104,716 $85,611 $14,198 $607,464
Special Revenue
128
Page 3 of 9
City of Eden Prairie, Minnesota
Combining Balance Sheet
Nonmajor Governmental Funds
December 31, 2023
ASSETS
Cash and Investments
Receivables
AccountsLease Receivable
Investment Interest
Lease Receivable Interest
Due from Other GovernmentsUnremitted Taxes
Delinquent Special Assessments
Deferred Special Assessments
Special Deferred Special Assessments
Due from Other Funds
Prepaid ItemsLease Receivable
Land Held for Resale
Notes Receivable (net of allow for uncollectible)
Total Assets
LIABILITIES
Accounts and Contracts Payable
Salaries Payable
Investment Interest PayableDue to Other Governments
Due to Other Funds
Unearned Revenue
Total Liabilities
DEFERRED INFLOWS OF RESOURCES
Deferred Inflow of Resource Related to Lease ReceivableUnavailable Revenue-Revenue
Unavailable Revenue-Special Assessments
Total Deferred Inflows of Resources
FUND BALANCES
Nonspendable
Restricted
Assigned
UnassignedTotal Fund Balance
Total Liabilities, Deferred Inflows of Resources, and Fund Balances
General General General GeneralObligation Obligation Obligation Obligation
Refunding Improvement Refunding Refunding
Bonds Bonds Bonds Bonds
2016A 10A/20A 11D/20A 12A/20A
$441,187 $138,572 $622,291 $343,045
- - - - - - - -
2,121 937 3,749 3,266
- - - -
- - - - - - - 3,266
- - 317 -
- 150,946 272,755 -
- - 120,762 -
- - - -
- - - - - - - -
- - - -
- - - -
$443,308 $290,455 $1,019,874 $349,577
$217 $217 $217 $217
- - - -
- - - - - - - -
- - - -
- - - -
217 217 217 217
- - - - - - - -
- 150,946 393,834 -
- 150,946 393,834 -
- - - -
443,091 139,292 625,823 349,360
- - - -
- - - - 443,091 139,292 625,823 349,360
$443,308 $290,455 $1,019,874 $349,577
Debt Service
129
Page 4 of 9
City of Eden Prairie, Minnesota
Combining Balance Sheet
Nonmajor Governmental Funds
December 31, 2023
ASSETS
Cash and Investments
Receivables
AccountsLease Receivable
Investment Interest
Lease Receivable Interest
Due from Other GovernmentsUnremitted Taxes
Delinquent Special Assessments
Deferred Special Assessments
Special Deferred Special Assessments
Due from Other Funds
Prepaid ItemsLease Receivable
Land Held for Resale
Notes Receivable (net of allow for uncollectible)
Total Assets
LIABILITIES
Accounts and Contracts Payable
Salaries Payable
Investment Interest PayableDue to Other Governments
Due to Other Funds
Unearned Revenue
Total Liabilities
DEFERRED INFLOWS OF RESOURCES
Deferred Inflow of Resource Related to Lease ReceivableUnavailable Revenue-Revenue
Unavailable Revenue-Special Assessments
Total Deferred Inflows of Resources
FUND BALANCES
Nonspendable
Restricted
Assigned
UnassignedTotal Fund Balance
Total Liabilities, Deferred Inflows of Resources, and Fund Balances
GeneralObligation General General
Refunding Obligation Obligation
Bonds Tax Abatement Bonds
12B/20A Bonds 2014A/21A 2016A Total
$51,798 $1,400,687 $125,319 $3,122,899
- - - - - - -
1,056 3,821 262 15,212
- - - -
- - - - 1,073 5,243 - 9,582
- - - 317
- - 845,931 1,269,632
- - - 120,762
- - - -
- - - - - - - -
- - - -
- - - -
$53,927 $1,409,751 $971,512 $4,538,404
$217 $217 $217 $1,519
- - - -
- - - - - - - -
- - - -
- - - -
217 217 217 1,519
- - - - - - - -
- - 845,931 1,390,711
- - 845,931 1,390,711
- - - -
53,710 1,409,534 125,364 3,146,174
- - - -
- - - - 53,710 1,409,534 125,364 3,146,174
$53,927 $1,409,751 $971,512 $4,538,404
Debt Service
130
Page 5 of 9
City of Eden Prairie, Minnesota
Combining Balance Sheet
Nonmajor Governmental Funds
December 31, 2023
ASSETS
Cash and Investments
Receivables
AccountsLease Receivable
Investment Interest
Lease Receivable Interest
Due from Other GovernmentsUnremitted Taxes
Delinquent Special Assessments
Deferred Special Assessments
Special Deferred Special Assessments
Due from Other Funds
Prepaid ItemsLease Receivable
Land Held for Resale
Notes Receivable (net of allow for uncollectible)
Total Assets
LIABILITIES
Accounts and Contracts Payable
Salaries Payable
Investment Interest PayableDue to Other Governments
Due to Other Funds
Unearned Revenue
Total Liabilities
DEFERRED INFLOWS OF RESOURCES
Deferred Inflow of Resource Related to Lease ReceivableUnavailable Revenue-Revenue
Unavailable Revenue-Special Assessments
Total Deferred Inflows of Resources
FUND BALANCES
Nonspendable
Restricted
Assigned
UnassignedTotal Fund Balance
Total Liabilities, Deferred Inflows of Resources, and Fund Balances
Senior Board Park
Police E-911 EP Players Improvement
$45,656 $231,655 $15,562 $4,764,242
- - - - - - - 9,128
295 972 89 31,986
- - - 1,439
- 13,715 - - - - - -
- - - -
- - - -
- - - -
- - - -
- 55,832 - - - - - 52,023
- - - -
- - - -
$45,951 $302,174 $15,651 $4,858,818
$3,948 $- $22 $175,164
1,251 - - -
- - - - - - - -
- - - -
- - - 312,505
5,199 - 22 487,669
- - - 71,796 - - - -
- - - -
- - - 71,796
- 55,832 - -
- 223,904 - 3,329,176
40,752 22,438 15,629 970,177
- - - - 40,752 302,174 15,629 4,299,353
$45,951 $302,174 $15,651 $4,858,818
Capital Projects
131
Page 6 of 9
City of Eden Prairie, Minnesota
Combining Balance Sheet
Nonmajor Governmental Funds
December 31, 2023
ASSETS
Cash and Investments
Receivables
AccountsLease Receivable
Investment Interest
Lease Receivable Interest
Due from Other GovernmentsUnremitted Taxes
Delinquent Special Assessments
Deferred Special Assessments
Special Deferred Special Assessments
Due from Other Funds
Prepaid ItemsLease Receivable
Land Held for Resale
Notes Receivable (net of allow for uncollectible)
Total Assets
LIABILITIES
Accounts and Contracts Payable
Salaries Payable
Investment Interest PayableDue to Other Governments
Due to Other Funds
Unearned Revenue
Total Liabilities
DEFERRED INFLOWS OF RESOURCES
Deferred Inflow of Resource Related to Lease ReceivableUnavailable Revenue-Revenue
Unavailable Revenue-Special Assessments
Total Deferred Inflows of Resources
FUND BALANCES
Nonspendable
Restricted
Assigned
UnassignedTotal Fund Balance
Total Liabilities, Deferred Inflows of Resources, and Fund Balances
CIP Economic
CIP Pavement Development Project
Trails Management Fund Fund
$1,102,121 $1,066,191 $2,702,628 $4,727,415
- 1,342,025 - - - - 77,739 -
3,853 14,435 16,303 25,698
- - 826 -
- - - - - - - 30,385
- - - -
45,001 - - -
- - - -
- - - -
- - - - - - 227,260 -
- - 808,000 -
- - - 1,212,024
$1,150,975 $2,422,651 $3,832,756 $5,995,522
$640 $9,665 $18,940 $23,860
- - - -
- - - - - - - 10,548
- - - -
- - - -
640 9,665 18,940 34,408
- - 293,018 - - - - -
45,001 - - -
45,001 - 293,018 -
- - - -
- 1,004,524 - 3,901,204
1,105,334 1,408,462 3,520,798 2,059,910
- - - - 1,105,334 2,412,986 3,520,798 5,961,114
$1,150,975 $2,422,651 $3,832,756 $5,995,522
Capital Projects
132
Page 7 of 9
City of Eden Prairie, Minnesota
Combining Balance Sheet
Nonmajor Governmental Funds
December 31, 2023
ASSETS
Cash and Investments
Receivables
AccountsLease Receivable
Investment Interest
Lease Receivable Interest
Due from Other GovernmentsUnremitted Taxes
Delinquent Special Assessments
Deferred Special Assessments
Special Deferred Special Assessments
Due from Other Funds
Prepaid ItemsLease Receivable
Land Held for Resale
Notes Receivable (net of allow for uncollectible)
Total Assets
LIABILITIES
Accounts and Contracts Payable
Salaries Payable
Investment Interest PayableDue to Other Governments
Due to Other Funds
Unearned Revenue
Total Liabilities
DEFERRED INFLOWS OF RESOURCES
Deferred Inflow of Resource Related to Lease ReceivableUnavailable Revenue-Revenue
Unavailable Revenue-Special Assessments
Total Deferred Inflows of Resources
FUND BALANCES
Nonspendable
Restricted
Assigned
UnassignedTotal Fund Balance
Total Liabilities, Deferred Inflows of Resources, and Fund Balances
Shady Oak
Tree Road
HRA Replacement Transportation North
$329,495 $320,332 $3,369,220 $121,357
- - - - - - - -
1,625 1,883 30,312 3,393
- - - -
- - 470,000 - 600 - - -
- - - -
- - 23,336 -
- - 820,352 -
- - - -
- - - - - - - -
- - - -
- - - -
$331,720 $322,215 $4,713,220 $124,750
$- $- $67,532 $17,490
5,173 - - -
- - - - - - - -
- - - -
- - 470,000 -
5,173 - 537,532 17,490
- - - - - - - -
- - 843,688 -
- - 843,688 -
- - - -
- 308,187 - 77,419
326,547 14,028 3,332,000 29,841
- - - - 326,547 322,215 3,332,000 107,260
$331,720 $322,215 $4,713,220 $124,750
Capital Projects
133
Page 8 of 9
City of Eden Prairie, Minnesota
Combining Balance Sheet
Nonmajor Governmental Funds
December 31, 2023
ASSETS
Cash and Investments
Receivables
AccountsLease Receivable
Investment Interest
Lease Receivable Interest
Due from Other GovernmentsUnremitted Taxes
Delinquent Special Assessments
Deferred Special Assessments
Special Deferred Special Assessments
Due from Other Funds
Prepaid ItemsLease Receivable
Land Held for Resale
Notes Receivable (net of allow for uncollectible)
Total Assets
LIABILITIES
Accounts and Contracts Payable
Salaries Payable
Investment Interest PayableDue to Other Governments
Due to Other Funds
Unearned Revenue
Total Liabilities
DEFERRED INFLOWS OF RESOURCES
Deferred Inflow of Resource Related to Lease ReceivableUnavailable Revenue-Revenue
Unavailable Revenue-Special Assessments
Total Deferred Inflows of Resources
FUND BALANCES
Nonspendable
Restricted
Assigned
UnassignedTotal Fund Balance
Total Liabilities, Deferred Inflows of Resources, and Fund Balances
Eden Prairie Rd Homeowners Duck
Cable Connect to Improvements Lake Road
PEG Flying Cloud Area Reconstruction
$348,449 $- $11,683 $-
53,867 - - - - - - -
1,750 - 47 -
- - - -
- - - - - - - -
- - - -
- - 16,783 -
- - - -
- - - -
5,091 - - - - - - -
- - - -
- - - -
$409,157 $- $28,513 $-
$- $- $- $-
- - - -
- - - - - - - -
- - - -
- - - -
- - - -
- - - - - - - -
- - 16,783 -
- - 16,783 -
5,091 - - -
376,460 - 11,540 -
27,606 - 190 -
- - - - 409,157 - 11,730 -
$409,157 $- $28,513 $-
Capital Projects
134
Page 9 of 9
City of Eden Prairie, Minnesota
Combining Balance Sheet
Nonmajor Governmental Funds
December 31, 2023
ASSETS
Cash and Investments
Receivables
AccountsLease Receivable
Investment Interest
Lease Receivable Interest
Due from Other GovernmentsUnremitted Taxes
Delinquent Special Assessments
Deferred Special Assessments
Special Deferred Special Assessments
Due from Other Funds
Prepaid ItemsLease Receivable
Land Held for Resale
Notes Receivable (net of allow for uncollectible)
Total Assets
LIABILITIES
Accounts and Contracts Payable
Salaries Payable
Investment Interest PayableDue to Other Governments
Due to Other Funds
Unearned Revenue
Total Liabilities
DEFERRED INFLOWS OF RESOURCES
Deferred Inflow of Resource Related to Lease ReceivableUnavailable Revenue-Revenue
Unavailable Revenue-Special Assessments
Total Deferred Inflows of Resources
FUND BALANCES
Nonspendable
Restricted
Assigned
UnassignedTotal Fund Balance
Total Liabilities, Deferred Inflows of Resources, and Fund Balances
Cemetery Total
Perpetual Nonmajor
Dell Willow Creek Care Governmental
Road Utilities Total Fund Funds
$1,874,709 $- $21,030,715 $231,214 $24,885,515
- - 1,395,892 640 1,401,403 - - 86,867 - 86,867
- - 132,641 1,279 151,396
- - 2,265 - 2,265
- - 483,715 - 561,361 - - 30,985 - 40,567
- - - - 317
- - 85,120 - 1,354,752
- - 820,352 - 941,114
44,511 - 44,511 - 66,507
- - 60,923 - 60,923 - - 279,283 - 279,283
- - 808,000 - 808,000
- - 1,212,024 - 1,212,024
$1,919,220 $- $26,473,293 $233,133 $31,852,294
$- $1,362 $318,623 $480 $344,183
- - 6,424 - 11,252
420 86 506 - 506 - - 10,548 - 10,617
- 44,511 44,511 - 66,507
- - 782,505 - 783,655
420 45,959 1,163,117 480 1,216,720
- - 364,814 - 364,814 - - - - 375
- - 905,472 - 2,296,183
- - 1,270,286 - 2,661,372
- - 60,923 201,349 262,272
- - 9,232,414 31,304 12,965,377
1,918,800 - 14,792,512 - 14,792,512
- (45,959) (45,959) - (45,959) 1,918,800 (45,959) 24,039,890 232,653 27,974,202
$1,919,220 $- $26,473,293 $233,133 $31,852,294
Capital Projects
Permanent
Fund
135
Page 1 of 9
City of Eden Prairie, Minnesota
Combining Statement of Revenues,
Expenditures, and Changes in Fund Balances
Nonmajor Governmental Funds
For the Year Ended December 31, 2023
Pleasant Eden
HRA Hills Prairie Grant
Grant Cemetery Cemetery Fund
REVENUES
General Property Taxes $- $- $- $-
Special Assessments - - - -
Licenses and Permits - - - -
Intergovernmental Revenue 621,585 - - 123,724
Charges for Services - 46,890 73,450 - Fines and Forfeits - - - -
Investment Income - 6,582 2,298 2,014 Lease Income - - - -
Rental - - - - Other
Contributions and Donations - - - - Miscellaneous - - - -
Total Revenues 621,585 53,472 75,748 125,738
EXPENDITURES
Current
Community Development 621,585 - - -
Police - - - 115,877
Public Works - - - -
Parks and Recreation - 36,551 25,914 -
Capital Outlay
Administration - - - -
Community Development - - - -
Police - - - -
Public Works - - - -
Parks and Recreation - - - -
Debt Service
Principal - - - -
Interest - - - -
Fiscal Agent Fees - - - -
Total Expenditures 621,585 36,551 25,914 115,877
Excess of Revenues Over (Under) Expenditures - 16,921 49,834 9,861
OTHER FINANCING SOURCES (USES)
Issuance of Debt - - - -
Transfers In - - - -
Transfers Out - - - -
Total Other Financing Sources (Uses)- - - -
Net Change in Fund Balances - 16,921 49,834 9,861
Fund Balances (Deficit) - Beginning - 146,558 65,671 68,127
Fund Balances (Deficit) - Ending $- $163,479 $115,505 $77,988
Special Revenue
136
Page 2 of 9
City of Eden Prairie, Minnesota
Combining Statement of Revenues,
Expenditures, and Changes in Fund Balances
Nonmajor Governmental Funds
For the Year Ended December 31, 2023
REVENUES
General Property Taxes
Special Assessments
Licenses and Permits
Intergovernmental Revenue
Charges for ServicesFines and Forfeits
Investment Income Lease Income
RentalOther
Contributions and DonationsMiscellaneous
Total Revenues
EXPENDITURES
Current
Community Development
Police
Public Works
Parks and Recreation
Capital Outlay
Administration
Community Development
Police
Public Works
Parks and Recreation
Debt Service
Principal
Interest
Fiscal Agent Fees
Total Expenditures
Excess of Revenues Over (Under) Expenditures
OTHER FINANCING SOURCES (USES)
Issuance of Debt
Transfers In
Transfers Out
Total Other Financing Sources (Uses)
Net Change in Fund Balances
Fund Balances (Deficit) - Beginning
Fund Balances (Deficit) - Ending
Historical
Opioid and
Recycling Settlement Cultural Total
$- $- $- $-
- - - -
- - - -
112,192 - - 857,501
- - - 120,340 - - - -
- 1,680 1,678 14,252 - - - -
- - - -
- - - -
145 33,962 1,413 35,520
112,337 35,642 3,091 1,027,613
- - 26,487 648,072
- 39,534 - 155,411
60,516 - - 60,516
- - - 62,465
- - - -
- - - -
- - - -
- - - -
- - - -
- - - -
- - - -
- - - -
60,516 39,534 26,487 926,464
51,821 (3,892) (23,396) 101,149
- - - -
- - - -
- - - -
- - - -
51,821 (3,892) (23,396) 101,149
49,215 89,503 35,262 454,336
$101,036 $85,611 $11,866 $555,485
Special Revenue
137
Page 3 of 9
City of Eden Prairie, Minnesota
Combining Statement of Revenues,
Expenditures, and Changes in Fund Balances
Nonmajor Governmental Funds
For the Year Ended December 31, 2023
REVENUES
General Property Taxes
Special Assessments
Licenses and Permits
Intergovernmental Revenue
Charges for ServicesFines and Forfeits
Investment Income Lease Income
RentalOther
Contributions and DonationsMiscellaneous
Total Revenues
EXPENDITURES
Current
Community Development
Police
Public Works
Parks and Recreation
Capital Outlay
Administration
Community Development
Police
Public Works
Parks and Recreation
Debt Service
Principal
Interest
Fiscal Agent Fees
Total Expenditures
Excess of Revenues Over (Under) Expenditures
OTHER FINANCING SOURCES (USES)
Issuance of Debt
Transfers In
Transfers Out
Total Other Financing Sources (Uses)
Net Change in Fund Balances
Fund Balances (Deficit) - Beginning
Fund Balances (Deficit) - Ending
General General General General
Obligation Obligation Obligation Obligation
Refunding Improvement Refunding Refunding
Bonds Bonds Bonds Bonds
2016A 10A/20A 11D/20A 12A/20A
$- $- $- $900,356
116,878 87,367 185,708 -
- - - -
- - - -
- - - - - - - -
17,179 7,737 29,872 26,434 - - - -
- - - -
- - - -
- - - -
134,057 95,104 215,580 926,790
- - - -
- - - -
- - - -
- - - -
- - - -
- - - -
- - - -
- - - -
- - - -
120,000 91,000 177,000 884,000
5,400 2,380 4,522 22,695
657 657 657 657
126,057 94,037 182,179 907,352
8,000 1,067 33,401 19,438
- - - -
- - - -
- - - -
- - - -
8,000 1,067 33,401 19,438
435,091 138,225 592,422 329,922
$443,091 $139,292 $625,823 $349,360
Debt Service
138
Page 4 of 9
City of Eden Prairie, Minnesota
Combining Statement of Revenues,
Expenditures, and Changes in Fund Balances
Nonmajor Governmental Funds
For the Year Ended December 31, 2023
REVENUES
General Property Taxes
Special Assessments
Licenses and Permits
Intergovernmental Revenue
Charges for ServicesFines and Forfeits
Investment Income Lease Income
RentalOther
Contributions and DonationsMiscellaneous
Total Revenues
EXPENDITURES
Current
Community Development
Police
Public Works
Parks and Recreation
Capital Outlay
Administration
Community Development
Police
Public Works
Parks and Recreation
Debt Service
Principal
Interest
Fiscal Agent Fees
Total Expenditures
Excess of Revenues Over (Under) Expenditures
OTHER FINANCING SOURCES (USES)
Issuance of Debt
Transfers In
Transfers Out
Total Other Financing Sources (Uses)
Net Change in Fund Balances
Fund Balances (Deficit) - Beginning
Fund Balances (Deficit) - Ending
General
Obligation General General
Refunding Obligation Obligation
Bonds Tax Abatement Bonds
12B/20A Bonds 2014A/21A 2016A Total
$277,399 $1,355,291 $- $2,533,046
- - 143,813 533,766
- - - -
- - - -
- - - - - - - -
10,489 53,376 1,891 146,978 - - - -
- - - -
- - - -
- - - -
287,888 1,408,667 145,704 3,213,790
- - - -
- - - -
- - - -
- - - -
- - - -
- - - -
- - - -
- - - -
- - - -
334,000 755,000 110,000 2,471,000
8,525 378,400 26,010 447,932
657 1,157 657 5,099
343,182 1,134,557 136,667 2,924,031
(55,294) 274,110 9,037 289,759
- - - -
- - - -
- - - -
- - - -
(55,294) 274,110 9,037 289,759
109,004 1,135,424 116,327 2,856,415
$53,710 $1,409,534 $125,364 $3,146,174
Debt Service
139
Page 5 of 9
City of Eden Prairie, Minnesota
Combining Statement of Revenues,
Expenditures, and Changes in Fund Balances
Nonmajor Governmental Funds
For the Year Ended December 31, 2023
REVENUES
General Property Taxes
Special Assessments
Licenses and Permits
Intergovernmental Revenue
Charges for ServicesFines and Forfeits
Investment Income Lease Income
RentalOther
Contributions and DonationsMiscellaneous
Total Revenues
EXPENDITURES
Current
Community Development
Police
Public Works
Parks and Recreation
Capital Outlay
Administration
Community Development
Police
Public Works
Parks and Recreation
Debt Service
Principal
Interest
Fiscal Agent Fees
Total Expenditures
Excess of Revenues Over (Under) Expenditures
OTHER FINANCING SOURCES (USES)
Issuance of Debt
Transfers In
Transfers Out
Total Other Financing Sources (Uses)
Net Change in Fund Balances
Fund Balances (Deficit) - Beginning
Fund Balances (Deficit) - Ending
Senior Board Park
Police E-911 EP Players Improvement
$- $- $- $-
- - - -
- - - -
- 205,706 - -
- - - 1,123,835 2,250 - - -
1,912 3,390 743 239,646 - - - 1,439
- - - 2,903
- - - 41,643
6,251 - 3,464 -
10,413 209,096 4,207 1,409,466
- - - -
23,482 83,086 - -
- - - -
- - 2,634 -
- - - -
- - - -
- 36,491 - -
- - - -
- - - 2,216,542
12,800 - -
- - - -
- - - -
23,482 132,377 2,634 2,216,542
(13,069) 76,719 1,573 (807,076)
- 36,491 - -
- - - 20,000
- - (1,000) -
- 36,491 (1,000) 20,000
(13,069) 113,210 573 (787,076)
53,821 188,964 15,056 5,086,429
$40,752 $302,174 $15,629 $4,299,353
Capital Projects
140
Page 6 of 9
City of Eden Prairie, Minnesota
Combining Statement of Revenues,
Expenditures, and Changes in Fund Balances
Nonmajor Governmental Funds
For the Year Ended December 31, 2023
REVENUES
General Property Taxes
Special Assessments
Licenses and Permits
Intergovernmental Revenue
Charges for ServicesFines and Forfeits
Investment Income Lease Income
RentalOther
Contributions and DonationsMiscellaneous
Total Revenues
EXPENDITURES
Current
Community Development
Police
Public Works
Parks and Recreation
Capital Outlay
Administration
Community Development
Police
Public Works
Parks and Recreation
Debt Service
Principal
Interest
Fiscal Agent Fees
Total Expenditures
Excess of Revenues Over (Under) Expenditures
OTHER FINANCING SOURCES (USES)
Issuance of Debt
Transfers In
Transfers Out
Total Other Financing Sources (Uses)
Net Change in Fund Balances
Fund Balances (Deficit) - Beginning
Fund Balances (Deficit) - Ending
CIP Economic
CIP Pavement Development Project
Trails Mgmt Fund Fund
$- $- $- $2,576,991
18,808 - - -
- 4,682,041 - -
- 500,000 80,000 -
- - - - - - - -
24,019 140,725 131,468 202,837 - - 11,040 -
- - 78,827 -
- - - -
- - 67,013 -
42,827 5,322,766 368,348 2,779,828
- - - 2,268,011
- - - -
- - - -
- - - -
- - - -
- - 143,885 -
- - - -
62,916 4,156,057 153,465 -
- - - -
- - 5,686 -
- - 13 -
- - - -
62,916 4,156,057 303,049 2,268,011
(20,089) 1,166,709 65,299 511,817
- - - -
450,000 - - -
- (777,600) (47,092) -
450,000 (777,600) (47,092) -
429,911 389,109 18,207 511,817
675,423 2,023,877 3,502,591 5,449,297
$1,105,334 $2,412,986 $3,520,798 $5,961,114
Capital Projects
141
Page 7 of 9
City of Eden Prairie, Minnesota
Combining Statement of Revenues,
Expenditures, and Changes in Fund Balances
Nonmajor Governmental Funds
For the Year Ended December 31, 2023
REVENUES
General Property Taxes
Special Assessments
Licenses and Permits
Intergovernmental Revenue
Charges for ServicesFines and Forfeits
Investment Income Lease Income
RentalOther
Contributions and DonationsMiscellaneous
Total Revenues
EXPENDITURES
Current
Community Development
Police
Public Works
Parks and Recreation
Capital Outlay
Administration
Community Development
Police
Public Works
Parks and Recreation
Debt Service
Principal
Interest
Fiscal Agent Fees
Total Expenditures
Excess of Revenues Over (Under) Expenditures
OTHER FINANCING SOURCES (USES)
Issuance of Debt
Transfers In
Transfers Out
Total Other Financing Sources (Uses)
Net Change in Fund Balances
Fund Balances (Deficit) - Beginning
Fund Balances (Deficit) - Ending
Shady Oak
Tree Road
HRA Replacement Transportation North
$202,840 $- $- $-
- - 3,269 -
- - - -
- 9,250 - -
- - - - - - -
13,109 14,028 134,807 29,841 - - - -
- - - -
- 14,312 - -
- - - -
215,949 37,590 138,076 29,841
204,392 - - -
- - - -
- - - -
- - - -
- - - -
- - - -
- - - -
- - 239,855 584,326
- 38,102 - -
- - - -
- - - -
- - - -
204,392 38,102 239,855 584,326
11,557 (512) (101,779) (554,485)
- - - -
- - 2,776,521 -
- - - -
- - 2,776,521 -
11,557 (512) 2,674,742 (554,485)
314,990 322,727 657,258 661,745
$326,547 $322,215 $3,332,000 $107,260
Capital Projects
142
Page 8 of 9
City of Eden Prairie, Minnesota
Combining Statement of Revenues,
Expenditures, and Changes in Fund Balances
Nonmajor Governmental Funds
For the Year Ended December 31, 2023
REVENUES
General Property Taxes
Special Assessments
Licenses and Permits
Intergovernmental Revenue
Charges for ServicesFines and Forfeits
Investment Income Lease Income
RentalOther
Contributions and DonationsMiscellaneous
Total Revenues
EXPENDITURES
Current
Community Development
Police
Public Works
Parks and Recreation
Capital Outlay
Administration
Community Development
Police
Public Works
Parks and Recreation
Debt Service
Principal
Interest
Fiscal Agent Fees
Total Expenditures
Excess of Revenues Over (Under) Expenditures
OTHER FINANCING SOURCES (USES)
Issuance of Debt
Transfers In
Transfers Out
Total Other Financing Sources (Uses)
Net Change in Fund Balances
Fund Balances (Deficit) - Beginning
Fund Balances (Deficit) - Ending
Eden Prairie Rd Homeowners Duck Lake
Cable Connect to Improvements Road
PEG Flying Cloud Area Reconstruction
$- $- $- $-
- - 4,414 -
121,036 - - -
- 741,403 - -
- - - - - - - -
13,270 (45,731) 160 (4,155) - - - -
- - - -
- - - -
- - - 235,000
134,306 695,672 4,574 230,845
- - - -
- - - -
- - - -
- - - -
26,646 - - -
- - - -
- - - -
- 6,504 - 83,437
- - - -
- - - -
- - - -
- - - -
26,646 6,504 - 83,437
107,660 689,168 4,574 147,408
- - - -
- 285,658 - -
- - - (4,776,521)
- 285,658 - (4,776,521)
107,660 974,826 4,574 (4,629,113)
301,497 (974,826) 7,156 4,629,113
$409,157 $- $11,730 $-
Capital Projects
143
Page 9 of 9
City of Eden Prairie, Minnesota
Combining Statement of Revenues,
Expenditures, and Changes in Fund Balances
Nonmajor Governmental Funds
For the Year Ended December 31, 2023
REVENUES
General Property Taxes
Special Assessments
Licenses and Permits
Intergovernmental Revenue
Charges for ServicesFines and Forfeits
Investment Income Lease Income
RentalOther
Contributions and DonationsMiscellaneous
Total Revenues
EXPENDITURES
Current
Community Development
Police
Public Works
Parks and Recreation
Capital Outlay
Administration
Community Development
Police
Public Works
Parks and Recreation
Debt Service
Principal
Interest
Fiscal Agent Fees
Total Expenditures
Excess of Revenues Over (Under) Expenditures
OTHER FINANCING SOURCES (USES)
Issuance of Debt
Transfers In
Transfers Out
Total Other Financing Sources (Uses)
Net Change in Fund Balances
Fund Balances (Deficit) - Beginning
Fund Balances (Deficit) - Ending
Cemetery Total
Perpetual Nonmajor
Dell Willow Creek Care Governmental
Road Utilities Total Fund Funds
$- $- $2,779,831 $- $5,312,877
- - 26,491 - 560,257
- - 4,803,077 - 4,803,077
- - 1,536,359 - 2,393,860
- - 1,123,835 9,210 1,253,385 - - 2,250 - 2,250
(1,844) (302) 897,923 10,071 1,069,224 - - 12,479 - 12,479
- - 81,730 - 81,730
- - 55,955 - 55,955
- - 311,728 - 347,248
(1,844) (302) 11,631,658 19,281 15,892,342
- - 2,472,403 - 3,120,475
- - 106,568 - 261,979
- - - - 60,516
- - 2,634 720 65,819
- - 26,646 - 26,646
- - 143,885 - 143,885
- - 36,491 - 36,491
9,811 45,657 5,342,028 - 5,342,028
- - 2,254,644 - 2,254,644
- - 18,486 - 2,489,486
- - 13 - 447,945
- - - - 5,099
9,811 45,657 10,403,798 720 14,255,013
(11,655) (45,959) 1,227,860 18,561 1,637,329
- - 36,491 - 36,491
2,000,000 - 5,532,179 - 5,532,179
- - (5,602,213) - (5,602,213)
2,000,000 - (33,543) - (33,543)
1,988,345 (45,959) 1,194,317 18,561 1,603,786
(69,545) - 22,845,573 214,092 26,370,416
$1,918,800 $(45,959) $24,039,890 $232,653 $27,974,202
Permanent
FundCapital Projects
144
City of Eden Prairie, Minnesota Internal Service Funds Internal Service Funds Internal service funds are used to account for the financing of goods or services provided by one department or agency to other departments or agencies of the government and to other government units, on a cost reimbursement basis. Health & Benefits – This fund accounts for the activities pertaining to health, life and disability insurance. This fund also accounts for the employer’s portion of pension, FICA and Medicare contributions. Dental – This fund is to account for and finance its self-insured risk of loss for an employee dental plan. The dental plan is funded by the City, employee contributions, and investment earnings. Severance – This fund accounts for the payment of unused personal time off for governmental fund employees. Workers Compensation – This fund accounts for the costs associated with workers’ compensation. Revenues are primarily charges to other funds, interest earnings and insurance checks. Expenditures will consist of insurance premiums. Property Insurance – This fund accounts for the costs associated with the City’s property and casualty insurance program. Revenues are primarily charges to other funds and interest earnings. Expenditures will consist of insurance premiums. Facilities – This fund accounts for the costs associated with maintaining city owned buildings. Revenues are primarily charges to other funds, rental income, and interest earnings. Fleet – These funds account for the costs associated with maintaining and purchasing vehicles and equipment for the City. Revenues are primarily charges to other funds and interest earnings. Information Technology – These funds account for the provision of information technology services including infrastructure and applications. Revenues are primarily charges to other funds and interest earnings.
145
City of Eden Prairie, Minnesota
Internal Service Funds
Combining Statement of Net Position
December 31, 2023
Health &WorkersBenefitsDentalSeveranceCompensation
ASSETS
Current AssetsCash and Investments $2,050,768 $46,660 $983,692 $- ReceivablesAccounts 8,796 1,135 - - Lease Receivable - - - - Investment Interest 11,846 157 8,660 - Lease Receivable Interest - - - -
Due From Other Governments 38,558 - - - Due From Other Funds - - 557,359 -
Inventory - - - - Prepaid Items - - - 266,818 Total Current Assets 2,109,968 47,952 1,549,711 266,818
Noncurrent Assets:Lease Receivable - - - - Capital Assets
Not Being Depreciated or AmortizedWork in Progress - - - - Depreciated or AmortizedProperty, Plant and Equipment - - - - Leased IT Subscriptions - - - - Leased Building/Equipment - - - -
Less Accumulated Depreciation/Amortization - - - -
Total Noncurrent Assets - - - -
Total Assets 2,109,968 47,952 1,549,711 266,818
DEFERRED OUTFLOWS OF RESOURCES
Other Post Employment Benefits 801,853 - - 82 Total Deferred Outflows of Resources 801,853 - - 82
Total Assets and Deferred Outflows of Resources $2,911,821 $47,952 $1,549,711 $266,900
LIABILITIES
Current Liabilities:Accounts Payable $23,820 $7,760 $- $-
Claims Payable - 6,348 - - Salaries Payable - - 2,246 1,687
Investment Interest Payable - - - 994 IT Subscriptions Interest Payable - - - - IT Subscriptions Liabilities - - - - Lease Interest Payable - - - - Due to Other Governments 215,719 - - - Due to Other Funds - - - 557,359 Current Other Postemployment Benefits Liability 22,538 - - 2
Current Lease Liability Payable - - - - Current Portion of Compensated Absences - - 1,222,556 - Total Current Liabilities 262,077 14,108 1,224,802 560,042
Noncurrent Liabilities:Total Other Postemployment Benefits Liability 2,667,100 - - 554 IT Subscriptions Liabilities - - - -
Lease Liability Payable - - - - Compensated Absences - - 1,232,147 -
Total Noncurrent Liabilities 2,667,100 - 1,232,147 554
Total Liabilities 2,929,177 14,108 2,456,949 560,596
DEFERRED INFLOWS OF RESOURCESOther Postemployment Benefits 805,811 - - 86
Deferred Inflow of Resource Related to Lease Receivable - - - - Total Deferred Inflows of Resources 805,811 - - 86
Total Liabilities and Deferred Inflows of Resources 3,734,988 14,108 2,456,949 560,682
NET POSITION
Net Investment in Capital Assets - - - - Unrestricted (823,167) 33,844 (907,238) (293,782) Total Net Position (823,167) 33,844 (907,238) (293,782)
Total Liabilities and Deferred Inflows of Resources $2,911,821 $47,952 $1,549,711 $266,900
and Net Position
146
City of Eden Prairie, Minnesota
Internal Service Funds
Combining Statement of Net Position
December 31, 2023
ASSETS
Current AssetsCash and InvestmentsReceivablesAccounts Lease ReceivableInvestment Interest Lease Receivable Interest
Due From Other GovernmentsDue From Other Funds
InventoryPrepaid ItemsTotal Current Assets
Noncurrent Assets:Lease ReceivableCapital Assets
Not Being Depreciated or AmortizedWork in ProgressDepreciated or AmortizedProperty, Plant and EquipmentLeased IT SubscriptionsLeased Building/Equipment
Less Accumulated Depreciation/Amortization
Total Noncurrent Assets
Total Assets
DEFERRED OUTFLOWS OF RESOURCESOther Post Employment Benefits
Total Deferred Outflows of Resources
Total Assets and Deferred Outflows of Resources
LIABILITIES
Current Liabilities:Accounts Payable
Claims PayableSalaries Payable
Investment Interest PayableIT Subscriptions Interest PayableIT Subscriptions LiabilitiesLease Interest PayableDue to Other GovernmentsDue to Other FundsCurrent Other Postemployment Benefits Liability
Current Lease Liability PayableCurrent Portion of Compensated Absences
Total Current Liabilities
Noncurrent Liabilities:Total Other Postemployment Benefits LiabilityIT Subscriptions LiabilitiesLease Liability PayableCompensated Absences
Total Noncurrent Liabilities
Total Liabilities
DEFERRED INFLOWS OF RESOURCESOther Postemployment Benefits
Deferred Inflow of Resource Related to Lease ReceivableTotal Deferred Inflows of Resources
Total Liabilities and Deferred Inflows of Resources
NET POSITION
Net Investment in Capital AssetsUnrestricted Total Net Position
Total Liabilities and Deferred Inflows of Resources
and Net Position
Property InformationInsuranceFacilitiesFleetTechnology Total
$211,910 $4,149,780 $3,832,845 $1,905,946 $13,181,601
- 88,100 3,253 1,044 102,328 - 296 - - 296 1,383 21,264 24,704 9,841 77,855 - 1,610 - - 1,610
- - - - 38,558 - - - - 557,359
- - 170,744 - 170,744 176,800 39 1,500 167,642 612,799 390,093 4,261,089 4,033,046 2,084,473 14,743,150
- 32,806 - - 32,806
- - 1,228,992 - 1,228,992
- 3,931,370 11,894,855 1,000,093 16,826,318 - - - 1,160,733 1,160,733 - - - 116,896 116,896
- (1,362,613) (7,451,538) (971,802) (9,785,953)
- 2,601,563 5,672,309 1,305,920 9,579,792
390,093 6,862,652 9,705,355 3,390,393 24,322,942
82 9,248 8,695 4,660 824,620 82 9,248 8,695 4,660 824,620
$390,175 $6,871,900 $9,714,050 $3,395,053 $25,147,562
$1,268 $650,696 $434,458 $68,509 $1,186,511
- - - - 6,348 1,687 44,489 17,710 25,176 92,995
- - - - 994 - - - 18,097 18,097 - - - 245,779 245,779 - - - 212 212 - - 7,561 1,044 224,324 - - - - 557,359 2 248 187 130 23,107
- - - 23,617 23,617 - - - - 1,222,556 2,957 695,433 459,916 382,564 3,601,899
555 32,535 37,556 10,972 2,749,272 - - - 572,617 572,617
- - - 51,986 51,986 - - - - 1,232,147
555 32,535 37,556 635,575 4,606,022
3,512 727,968 497,472 1,018,139 8,207,921
86 9,078 7,701 4,661 827,423
- 30,983 - - 30,983 86 40,061 7,701 4,661 858,406
3,598 768,029 505,173 1,022,800 9,066,327
- 2,289,242 - 5,321,813 - 411,921 8,022,976 386,577 3,814,629 3,887,064 1,960,332 8,058,259 386,577 6,103,871 9,208,877 2,372,253 16,081,235
$390,175 $6,871,900 $9,714,050 $3,395,053 $25,147,562
147
City of Eden Prairie, Minnesota
Internal Service Funds
Combining Statement of Revenues
Expenses and Changes in Net Position
For the Year Ended December 31, 2023
Health &Workers
Benefits Dental Severance Compensation
OPERATING REVENUE
Charges for Services $6,833,446 $309,848 $233,679 $892,256
Rental - - - -
Lease Interest Income - - - -
Total Operating Revenues 6,833,446 309,848 233,679 892,256
OPERATING EXPENSE
Personnel Services 6,736,913 253,472 226,455 58,817
Supplies
Supplies - - - -
Cleaning Supplies - - - -
Motor Fuel - - - -
Tires - - - -
Repair and Maintenance Supplies - - - -
Contractual Services
Contractual Services 13,836 23,080 - 1,403,929
Software - - - -
Janitorial Services - - - -
Licenses, Permits, Taxes - - - -
Repair and Maintenance - - - -
Utilities - - - -
User Charges - - - -
Capital Under $25,000 - - - -
Total Operating Expenses 6,750,749 276,552 226,455 1,462,746
Operating Income (Loss) Before Depreciation/Amortization 82,697 33,296 7,224 (570,490)
Depreciation/Amortization - - - -
Operating Income (Loss) Before Nonoperating
Revenue / Expense 82,697 33,296 7,224 (570,490)
NONOPERATING REVENUE (EXPENSE)
Investment Income 94,465 548 66,793 (419) Lease Interest Expense - - - - Subscription Interest Expense - - - - Gain/(Loss) on Disposition of Capital Assets - - - - Contributions - - - - Miscellaneous 37,497 - - 44,804 Total Nonoperating Revenues (Expenses)131,962 548 66,793 44,385
Income (Loss) Before Contributions and Transfers 214,659 33,844 74,017 (526,105)
Contributions - from Governmental Activities - - - -
Change in Net Position 214,659 33,844 74,017 (526,105)
Net Position - Beginning (1,037,826) - (981,255) 232,323
Prior Period Adjustment (See Note 17)- - - -
Net Position - Beginning (Restated)(1,037,826) - (981,255) 232,323
Net Position - Ending $(823,167)$33,844 $(907,238)$(293,782)
148
City of Eden Prairie, Minnesota
Internal Service Funds
Combining Statement of Revenues
Expenses and Changes in Net Position
For the Year Ended December 31, 2023
OPERATING REVENUE
Charges for Services
Rental
Lease Interest Income
Total Operating Revenues
OPERATING EXPENSE
Personnel Services
Supplies
Supplies
Cleaning Supplies
Motor Fuel
Tires
Repair and Maintenance Supplies
Contractual Services
Contractual Services
Software
Janitorial Services
Licenses, Permits, Taxes
Repair and Maintenance
Utilities
User Charges
Capital Under $25,000
Total Operating Expenses
Operating Income (Loss) Before Depreciation/Amortization
Depreciation/Amortization
Operating Income (Loss) Before Nonoperating
Revenue / Expense
NONOPERATING REVENUE (EXPENSE)
Investment IncomeLease Interest ExpenseSubscription Interest ExpenseGain/(Loss) on Disposition of Capital AssetsContributionsMiscellaneousTotal Nonoperating Revenues (Expenses)
Income (Loss) Before Contributions and Transfers
Contributions - from Governmental Activities
Change in Net Position
Net Position - Beginning
Prior Period Adjustment (See Note 17)
Net Position - Beginning (Restated)
Net Position - Ending
Property Information
Insurance Facilities Fleet Technology Total
$835,957 $5,711,921 $3,106,525 $3,269,702 $21,193,334
- 622,325 - - 622,325
- 1,110 - - 1,110
835,957 6,335,356 3,106,525 3,269,702 21,816,769
58,816 1,316,609 586,982 825,246 10,063,310
- 3,645 73,159 6,506 83,310
- 98,290 - - 98,290
- 8,528 497,401 - 505,929
- - 75,161 - 75,161
- 299,309 414,778 - 714,087
966,401 1,615,117 11,331 166,151 4,199,845
- - - 1,198,092 1,198,092
- 892,553 - - 892,553
- 1,641 2,063 - 3,704
- - 293,147 - 293,147
- 1,458,116 17,122 172,546 1,647,784
- 23,427 - - 23,427
- 257,165 59,185 165,425 481,775
1,025,217 5,974,400 2,030,329 2,533,966 20,280,414
(189,260) 360,956 1,076,196 735,736 1,536,355
- 91,059 782,766 454,028 1,327,853
(189,260) 269,897 293,430 281,708 208,502
12,609 188,535 204,778 71,759 639,068 - - - (2,902) (2,902) - - - (31,895) (31,895) - - 179,677 - 179,677 - 2,673 - - 2,673 139,390 31,946 27,819 39,749 321,205 151,999 223,154 412,274 76,711 1,107,826
(37,261) 493,051 705,704 358,419 1,316,328
- - 360,806 - 360,806
(37,261) 493,051 1,066,510 358,419 1,677,134
423,838 5,610,820 8,142,367 1,850,937 14,241,204 - - - 162,897 162,897
423,838 5,610,820 8,142,367 2,013,834 14,404,101
$386,577 $6,103,871 $9,208,877 $2,372,253 $16,081,235
149
City of Eden Prairie, Minnesota
Internal Service Funds
Combining Statement of Cash Flows
For the Year Ended December 31, 2023
Health &WorkersBenefitsDentalSeveranceCompensation
CASH FLOWS FROM OPERATING ACTIVITIES
Receipts From Customers $6,833,591 $308,713 $233,679 $892,256
Payments to Vendors (13,799) (8,972) - (1,494,477) Payments to Employees (6,753,586) (253,472) (151,608) (58,805) Other Receipts - - - -
Net Cash Provided (Used) By Operating Activities 66,206 46,269 82,071 (661,026)
CASH FLOWS FROM INVESTING ACTIVITIES
Investment Income 88,671 391 62,301 922 Net Cash Provided (Used) By Investing Activities 88,671 391 62,301 922
CASH FLOWS FROM NONCAPITAL FINANCING ACTIVITIESPayments From Other Funds - - (557,359) -
Payments to Other Funds - - - 557,359 Miscellaneous 37,497 - - 44,804
Net Cash Provided (Used) By Noncapital Financing Activities 37,497 - (557,359) 602,163
CASH FLOWS FROM CAPITAL AND RELATED FINANCING ACTIVITESAcquisition and Construction of Capital Assets - - - -
Proceeds From Sale of Equipment - - - - Principal Paid on Debt - - - -
Interest and Fiscal Agent Paid on Debt - - - -
Net Cash Provided (Used) By Capital and Related Financing Activities - - - -
Net Increase (Decrease) in Cash and Cash Equivalents 192,374 46,660 (412,987) (57,941)
Cash and Cash Equivalents, January 1 1,858,394 - 1,396,679 57,941
Cash and Cash Equivalents, December 31 $2,050,768 $46,660 $983,692 $-
150
City of Eden Prairie, Minnesota
Internal Service Funds
Combining Statement of Cash Flows
For the Year Ended December 31, 2023
CASH FLOWS FROM OPERATING ACTIVITIES
Receipts From Customers
Payments to VendorsPayments to EmployeesOther Receipts
Net Cash Provided (Used) By Operating Activities
CASH FLOWS FROM INVESTING ACTIVITIES
Investment IncomeNet Cash Provided (Used) By Investing Activities
CASH FLOWS FROM NONCAPITAL FINANCING ACTIVITIESPayments From Other Funds
Payments to Other FundsMiscellaneous
Net Cash Provided (Used) By Noncapital Financing Activities
CASH FLOWS FROM CAPITAL AND RELATED FINANCING ACTIVITESAcquisition and Construction of Capital Assets
Proceeds From Sale of EquipmentPrincipal Paid on Debt
Interest and Fiscal Agent Paid on Debt
Net Cash Provided (Used) By Capital and Related Financing Activities
Net Increase (Decrease) in Cash and Cash Equivalents
Cash and Cash Equivalents, January 1
Cash and Cash Equivalents, December 31
Page 1 of 2
Property InformationInsuranceFacilitiesFleetTechnology Total
$835,957 $5,633,932 $3,105,209 $3,272,816 $21,116,153
(1,002,936) (4,428,919) (1,081,852) (1,662,565) (9,693,520) (58,804) (1,312,737) (586,944) (824,069) (10,000,025) - 621,561 - - 621,561
(225,783) 513,837 1,436,413 786,182 2,044,169
12,112 180,302 193,585 66,183 604,467 12,112 180,302 193,585 66,183 604,467
- - - - (557,359)
- - - - 557,359 139,390 34,619 27,819 39,749 323,878
139,390 34,619 27,819 39,749 323,878
- (386,300) (2,632,956) (183,675) (3,202,931)
- - 168,916 - 168,916 - - - (365,176) (365,176)
- - - (16,764) (16,764)
- (386,300) (2,464,040) (565,615) (3,415,955)
(74,281) 342,458 (806,223) 326,499 (443,441)
286,191 3,807,322 4,639,068 1,579,447 13,625,042
$211,910 $4,149,780 $3,832,845 $1,905,946 $13,181,601
151
City of Eden Prairie, Minnesota
Internal Service Funds
Combining Statement of Cash Flows
For the Year Ended December 31, 2023
Health &WorkersBenefitsDentalSeveranceCompensation
RECONCILIATION OF OPERATING INCOME
(LOSS) TO NET CASH PROVIDED (USED)
BY OPERATING ACTIVITIES:
Operating Income (Loss)$82,697 $33,296 $7,224 $(570,490) Adjustments to Reconcile Operating Income (Loss)
to Net Cash Provided (Used) by Operating Activities:Depreciation/Amortization - - - - (Increase) Decrease in Assets:
Accounts Receivable 145 (1,135) - - Lease Receivable - - - -
Due From Other Governments (30,180) - - - Inventory - - - - Prepaid Items 26,715 - - (90,548)
Other Post Employment Benefits (Deferred Outflow)121,708 - - 14 Increase (Decrease) in Liabilities:
Accounts Payable (1,658) 14,108 - - Salaries Payable - - (3,112) 14 Unearned Revenue - - - -
Due to Other Governments 5,160 - - - Current Other Postemployment Benefits Liability 334,199 - - 36
Other Post Employment Benefits (Deferred Inflow)(472,580) - - (52) Compensated Absences - - 77,959 -
Net Cash Provided (Used) by Operating Activities $66,206 $46,269 $82,071 $(661,026)
Noncash Investing, Capital and Financing Activities:Contributions of Capital Assets from Governmental Activities $- $- $- $-
152
City of Eden Prairie, Minnesota
Internal Service Funds
Combining Statement of Cash Flows
For the Year Ended December 31, 2023
RECONCILIATION OF OPERATING INCOME
(LOSS) TO NET CASH PROVIDED (USED)
BY OPERATING ACTIVITIES:
Operating Income (Loss)Adjustments to Reconcile Operating Income (Loss)
to Net Cash Provided (Used) by Operating Activities:Depreciation/Amortization(Increase) Decrease in Assets:
Accounts ReceivableLease Receivable
Due From Other GovernmentsInventoryPrepaid Items
Other Post Employment Benefits (Deferred Outflow)Increase (Decrease) in Liabilities:
Accounts PayableSalaries PayableUnearned Revenue
Due to Other GovernmentsCurrent Other Postemployment Benefits Liability
Other Post Employment Benefits (Deferred Inflow)Compensated Absences
Net Cash Provided (Used) by Operating Activities
Noncash Investing, Capital and Financing Activities:Contributions of Capital Assets from Governmental Activities
Page 2 of 2
Property InformationInsuranceFacilitiesFleetTechnology Total
$(189,260) $269,897 $293,430 $281,708 $208,502
- 91,059 782,766 454,028 1,327,853
- (77,354) (1,316) 3,114 (76,546) - (1,874) - - (1,874)
- 20,728 - - (9,452) - - 16,927 - 16,927 (36,803) - - 109,311 8,675
14 1,339 1,008 702 124,785
268 208,144 339,032 (63,500) 496,394 14 4,055 175 1,273 2,419 - (635) - - (635)
- - 5,536 344 11,040 36 3,677 2,767 1,930 342,645
(52) (5,199) (3,912) (2,728) (484,523) - - - - 77,959
$(225,783) $513,837 $1,436,413 $786,182 $2,044,169
$- $- $360,806 $- $360,806
153
City of Eden Prairie, Minnesota Custodial Funds Custodial Funds Custodial funds are used to account for assets held by the government as an agent for individuals, private organizations, other governments, or other funds. WAFTA – This fund accounts for the collection and remittance of expenses pertaining to the fire training facility owned by 11 member cities. MCES - This fund accounts for the collection and remittance of sewer availability charges to the Metropolitan Council Environmental Services. Escrow - This fund is used to account for evidence held by the Police Department. Fencing – The seven-county metro area has formed a Fencing Consortium to provide anti-scale fencing. The intent of the Fencing Consortium is to provide anti-scale fencing within hours around potentially impacted government buildings in response to a critical incident. The Consortium is funded by
membership dues. I-494 Corridor Commission – This fund accounts for the collection and remittance of expenses pertaining to the policy work and employer and commuter outreach performed by staff of the I-494 Corridor Commission. The Commission is funded by member cities, a federal Congestion Mitigation & Air Quality grant, and a Telework state grant.
154
City of Eden Prairie, Minnesota
Fiduciary Funds
Statement of Fiduciary Net Position
December 31, 2023
Custodial
Funds
WAFTA MCES Escrow Fencing I-494 Total
ASSETS
Cash and Investments $376,178 $2,485 $117,104 $56,475 $90,801 $643,043
Due from Other Governments - - - - 98,894 98,894
Prepaids 937 - - 57,441 7,764 66,142
Total Assets $377,115 $2,485 $117,104 $113,916 $197,459 $808,079
LIABILITIES
Accounts Payable $- $- $87,706 $- $10,653 $98,359
Due to Other Governments - 2,485 - - 1,936 4,421 Total Liabilities $- $2,485 $87,706 $- $12,589 $102,780
NET POSITION
Restricted For:
Police Evidence Cash $- $- $29,398 $- $- $29,398
Western Area Fire Training Costs 377,115 - - - - 377,115
Fencing Consortium Costs - - - 113,916 - 113,916
I-494 Corridior Commission Costs - - - - 184,870 184,870
$377,115 $- $29,398 $113,916 $184,870 $705,299
155
City of Eden Prairie, Minnesota
Fiduciary Funds
Statement of Changes in Fiduciary Net Position
For the Year Ended December 31, 2023
Custodial
Funds
WAFTA MCES Escrow Fencing I-494 Total
ADDITIONS
Grants $- $- $- $- $379,335 $379,335
Memberships 22,000 - - 302,020 168,030 492,050
Investments Earnings 16,101 - - 5,639 10,346 32,086
Building Permits - 656,040 - - - 656,040
Other - - 11,484 - 1,408 12,892
Total Additions 38,101 656,040 11,484 307,659 559,119 1,572,403
DEDUCTIONS
Personnel Services - - - - 427,437 427,437
Supplies - - - 359 27,419 27,778
Contractual Services 1,642 656,040 - 193,384 230,028 1,081,094
Total Deductions 1,642 656,040 - 193,743 684,884 1,536,309
Net Increase (Decrease) in Fiduciary Net Position 36,459 - 11,484 113,916 (125,765)36,094
Net Position - Beginning 340,656 - 17,914 - 310,635 669,205
Net Position - Ending $377,115 $- $29,398 $113,916 $184,870 $705,299
156
STATISTICAL SECTION
157
City of Eden Prairie, Minnesota Statistical Section (Unaudited) This part of the City of Eden Prairie’s annual comprehensive financial report presents detailed information as a context for understanding this year’s financial statements, note disclosures, and supplementary information. This information has not been audited by the independent auditor. Contents Page Financial Trends ........................................................................................................................................................159-164 These tables contain trend information that may assist the reader in assessing the City’s current financial performance by placing it in historical perspective. Revenue Capacity .................................................................................................................................................. 165-168 These tables contain information that may assist the reader in assessing the viability of the City’s most significant “own-source” revenue, the property tax. Debt Capacity ..............................................................................................................................................................169-172 These tables present information that may assist the reader in analyzing the affordability of the City’s current levels of outstanding debt and the City’s ability to issue additional debt in the future. Demographic and Economic Information ......................................................................................................173-174 These tables offer economic and demographic indicators that are commonly used for financial analysis and that can increase one’s understanding of the City’s present and ongoing financial status. Operating Information ...........................................................................................................................................175-177 These tables contain service and infrastructure indicators that can increase one’s understanding of how the information in the City’s financial statements relates to the services the City provides and the activities it performs. Source: Unless otherwise noted, the information in these tables is derived from the annual comprehensive financial reports for the relevant year.
158
City of Eden Prairie, Minnesota Government-wide Net Position by Category (accrual basis of accounting) Last Ten Years
2014 2015 2016 2017 2018 2019 2020 2021 2022 2023
GOVERNMENTAL ACTIVITIES
Net Investment in Capital Assets $181,975,764 $189,217,647 $191,675,648 $195,150,960 $198,061,704 $204,564,164 $207,181,863 $209,098,130 $212,853,068 $219,430,606 Restricted 13,773,554 23,112,719 26,405,621 23,186,863 28,343,449 20,531,807 18,319,451 16,430,792 16,290,155 17,982,996
Unrestricted 60,341,383 31,911,221 21,694,457 29,707,881 29,069,260 33,229,904 44,514,934 59,396,843 65,028,175 66,653,801
Governmental Activities Net Position 256,090,701 244,241,587 239,775,726 248,045,704 255,474,413 258,325,875 270,016,248 284,925,765 294,171,398 304,067,403
BUSINESS-TYPE ACTIVITIES
Net Investment in Capital Assets 131,144,305 128,130,738 125,479,624 121,073,703 116,820,164 114,243,631 120,560,158 114,898,693 105,257,847 103,038,198 Unrestricted 14,438,525 14,792,266 16,155,406 19,142,578 22,590,071 25,296,848 22,267,651 27,910,252 33,151,502 41,489,192
Business-Type Activities Net Position 145,582,830 142,923,004 141,635,030 140,216,281 139,410,235 139,540,479 142,827,809 142,808,945 138,409,349 144,527,390
PRIMARY GOVERNMENT
Net Investment in Capital Assets 313,120,069 317,348,385 317,155,272 316,224,663 314,881,868 318,807,795 327,742,021 323,996,823 318,110,915 322,468,804
Restricted 13,773,554 23,112,719 26,405,621 23,186,863 28,343,449 20,531,807 18,319,451 16,430,792 16,290,155 17,982,996
Unrestricted 74,759,133 46,703,487 37,849,863 48,850,459 51,659,331 58,526,752 66,782,585 87,307,095 98,179,677 108,142,993
Primary Government Net Position $401,652,756 $387,164,591 $381,410,756 $388,261,985 $394,884,648 $397,866,354 $412,844,057 $427,734,710 $432,580,747 $448,594,793
159
City of Eden Prairie, Minnesota Changes in Net Position-Total (accrual basis of accounting) Last Ten Years
Source 2014 2015 2016 2017 2018 2019 2020 2021 2022 2023
EXPENSES
Governmental Activities $57,169,862 $65,402,641 $63,294,429 $60,402,652 $59,821,696 $67,623,543 $60,556,153 $61,204,663 $69,774,367 $70,960,838 Business-type Activities 29,820,423 27,924,045 30,170,309 28,922,085 30,324,121 30,033,843 30,124,648 33,758,571 36,179,924 35,524,608
Total Expenses 86,990,285 93,326,686 93,464,738 89,324,737 90,145,817 97,657,386 90,680,801 94,963,234 105,954,291 106,485,446
PROGRAM REVENUES
Governmental Activities 33,865,654 31,911,922 18,955,697 19,086,961 23,707,803 26,795,160 26,013,884 29,841,902 29,137,248 26,825,202 Business-type Activities 28,335,144 27,330,069 29,392,647 28,144,288 30,391,136 29,543,322 33,416,255 35,519,042 36,810,235 37,908,268
Total Program Revenues 62,200,798 59,241,991 48,348,344 47,231,249 54,098,939 56,338,482 59,430,139 65,360,944 65,947,483 64,733,470
Net (Expense) Revenue (24,789,487) (34,084,695) (45,116,394) (42,093,488) (36,046,878) (41,318,904) (31,250,662) (29,602,290) (40,006,808) (41,751,976)
GENERAL REVENUES AND TRANSFERS
Governmental Activities 37,961,763 37,694,597 39,872,871 41,618,266 43,542,602 43,679,845 46,232,642 46,272,278 49,882,752 53,082,482
Business-type Activities (1,367,634) 336,534 (510,312) (640,952) (873,061) 620,765 (4,277) (1,779,335) (5,029,907) 213,891 Total General Revenues and Transfers 36,594,129 38,031,131 39,362,559 40,977,314 42,669,541 44,300,610 46,228,365 44,492,943 44,852,845 53,296,373
Change in Net Position $11,804,642 $3,946,436 $(5,753,835) $(1,116,174) $6,622,663 $2,981,706 $14,977,703 $14,890,653 $4,846,037 $11,544,397
160
City of Eden Prairie, Minnesota Changes in Net Position-Governmental Activities (accrual basis of accounting) Last Ten Years
SOURCES 2014 2015 2016 2017 2018 2019 2020 2021 2022 2023
EXPENSES
Administration $4,921,044 $5,579,070 $5,003,957 $4,611,732 $5,092,886 $4,827,249 $5,554,966 $4,679,960 $5,751,886 $5,819,132
Community Development 5,368,762 7,730,338 5,692,215 6,222,326 4,942,029 4,771,490 4,767,416 5,198,300 5,986,996 5,762,042
Police 13,534,150 14,118,565 17,793,494 15,769,976 14,365,502 15,021,975 15,189,099 14,150,218 17,956,084 20,135,104
Fire 6,093,772 6,324,124 7,542,196 6,896,697 6,406,404 7,191,071 6,131,926 6,474,736 5,689,004 7,371,601 Public Works 13,321,459 17,652,163 11,035,229 10,616,604 10,098,667 19,518,141 14,981,533 14,706,067 16,584,584 13,711,989 Parks and Recreation 12,947,006 12,862,402 15,133,618 15,274,479 18,008,795 15,458,406 13,135,532 15,218,460 17,931,630 17,801,245 Interest on Long Term Debt 983,669 1,135,979 1,093,720 1,010,838 907,413 835,211 795,681 776,922 (125,817) 359,725 Total Expenses 57,169,862 65,402,641 63,294,429 60,402,652 59,821,696 67,623,543 60,556,153 61,204,663 69,774,367 70,960,838
PROGRAM REVENUES
Charges for Services
Administration 1,314,271 1,132,606 1,442,068 1,173,177 1,079,151 1,052,388 982,079 1,109,882 897,992 932,607
Community Development 73,929 93,195 152,708 127,248 161,918 180,443 142,353 124,707 85,127 76,298 Police 1,130,020 1,063,129 1,131,502 1,039,936 1,115,447 1,103,269 847,564 989,466 1,022,601 991,422
Fire 3,502,952 2,571,830 2,315,725 2,240,351 3,505,901 3,580,095 3,609,503 4,696,599 3,948,568 3,719,560 Public Works 411,144 975,701 330,709 218,292 274,679 1,070,746 329,277 214,521 336,140 368,949 Parks and Recreation 5,187,195 5,229,060 5,513,331 6,091,247 5,854,094 6,004,835 2,445,386 5,559,244 7,052,917 6,920,145 Operating Grants and Contributions 1,741,945 1,818,333 1,614,263 1,707,453 2,457,482 2,461,663 7,376,216 6,509,714 6,798,808 3,227,456 Capital Grants and Contributions 20,504,198 19,028,068 6,455,391 6,489,257 9,259,131 11,341,721 10,281,506 10,637,769 8,995,095 10,588,765 Total Program Revenues 33,865,654 31,911,922 18,955,697 19,086,961 23,707,803 26,795,160 26,013,884 29,841,902 29,137,248 26,825,202
Net (Expense) Revenue (23,304,208) (33,490,719) (44,338,732) (41,315,691) (36,113,893) (40,828,383) (34,542,269) (31,362,761) (40,637,119) (44,135,636)
GENERAL REVENUES AND TRANSFERS
Taxes
Property Taxes 32,781,740 33,708,909 34,217,549 35,405,930 37,338,583 38,203,969 39,864,882 40,478,282 43,333,223 44,019,754
Tax Increment 3,070,936 3,249,355 3,357,247 3,570,703 2,320,447 1,936,046 2,193,637 2,681,357 2,750,448 2,576,991
Gain on Sale of Capital Assets - - - - - - - - - 167,444
Grants and Contributions Not Restricted
to Specific Programs 483,914 741,828 1,268,257 1,545,745 1,644,788 1,718,391 1,788,293 1,836,431 971,536 565,167
Investment Income 210,373 272,989 418,849 334,305 988,382 1,747,241 1,651,912 (335,188) (1,511,717) 4,004,805
Transfers 1,414,800 (278,484) 610,969 761,583 1,250,402 74,198 733,918 1,611,396 4,339,262 1,748,321
Total General Revenues and Transfers 37,961,763 37,694,597 39,872,871 41,618,266 43,542,602 43,679,845 46,232,642 46,272,278 49,882,752 53,082,482
Change in Net Position $14,657,555 $4,203,878 $(4,465,861) $302,575 $7,428,709 $2,851,462 $11,690,373 $14,909,517 $9,245,633 $8,946,846
161
City of Eden Prairie, Minnesota Changes in Net Position-Business-type Activities (accrual basis of accounting) Last Ten Years
SOURCE 2014 2015 2016 2017 2018 2019 2020 2021 2022 2023
EXPENSES
Water $9,856,001 $8,905,768 $10,526,151 $9,686,669 $10,460,599 $9,708,148 $9,481,491 $12,433,736 $13,549,136 $13,276,328 Wastewater 6,403,264 6,565,966 7,407,149 6,913,276 7,469,070 7,678,652 7,496,256 7,504,396 8,375,360 7,692,294
Stormwater 2,545,818 2,082,594 1,793,588 2,437,573 2,351,367 2,413,725 2,538,257 2,894,253 3,170,444 3,268,137
Liquor 11,015,340 10,369,717 10,443,421 9,884,567 10,043,085 10,233,318 10,608,644 10,926,186 11,084,984 11,287,849
Total Expenses 29,820,423 27,924,045 30,170,309 28,922,085 30,324,121 30,033,843 30,124,648 33,758,571 36,179,924 35,524,608
PROGRAM REVENUES
Charges for Services
Water 7,315,328 7,162,740 7,675,337 7,846,540 8,422,155 7,699,582 8,987,364 10,682,945 11,008,837 11,831,046
Wastewater 5,566,951 5,661,990 5,789,584 5,863,517 6,356,014 6,726,548 6,895,764 7,460,750 7,517,471 7,725,339 Stormwater 1,656,817 1,933,572 2,095,629 2,400,254 2,786,754 3,125,251 3,376,785 3,631,369 3,770,562 3,879,587 Liquor 12,216,404 11,312,822 10,747,887 10,501,449 10,848,725 10,977,643 11,711,560 11,923,359 12,067,226 12,069,015
Operating Grants and Contributions 131,600 133,195 155,041 238,392 20,665 69,429 117,123 68,185 107,493 45,315
Capital Grants and Contributions 1,448,044 1,125,750 2,929,169 1,294,136 1,956,823 944,869 2,327,659 1,752,434 2,338,646 2,357,966
Total Program Revenues 28,335,144 27,330,069 29,392,647 28,144,288 30,391,136 29,543,322 33,416,255 35,519,042 36,810,235 37,908,268
Net (Expense) Revenue (1,485,279) (593,976) (777,662) (777,797) 67,015 (490,521) 3,291,607 1,760,471 630,311 2,383,660
GENERAL REVENUES AND TRANSFERS
Grants and Contributions Not Restricted - - - - - - - - - 117,647 to Specific Programs
Gain on Sale of Capital Assets - - - - - - - - - 3,563
Investment Income 47,166 58,050 100,657 120,631 377,341 694,963 729,641 (167,939) (690,645) 1,841,002
Transfers (1,414,800) 278,484 (610,969) (761,583) (1,250,402) (74,198) (733,918) (1,611,396) (4,339,262) (1,748,321) Total General Revenues and Transfers (1,367,634) 336,534 (510,312) (640,952) (873,061) 620,765 (4,277) (1,779,335) (5,029,907) 213,891
Change in Net Position $(2,852,913) $(257,442) $(1,287,974) $(1,418,749) $(806,046) $130,244 $3,287,330 $(18,864) $(4,399,596) $2,597,551
162
City of Eden Prairie, Minnesota Fund Balances-Governmental Funds Last Ten Years
2014 2015 2016 2017 2018 2019 2020 2021 2022 2023
GENERAL FUND
Nonspendable $39,844 $22,947 $35,792 $30,037 $103,845 $69,611 $94,824 $187,378 $180,596 $109,576
Restricted - - 286,942 - - 11,148 10,572 - - -
Unassigned 22,292,187 22,859,810 23,171,318 22,592,160 24,438,689 25,354,724 26,197,429 29,132,535 33,252,089 33,607,091 Subtotal General Fund 22,332,031 22,882,757 23,494,052 22,622,197 24,542,534 25,435,483 26,302,825 29,319,913 33,432,685 33,716,667
General Fund % Change 3.7% 2.5% 2.7% (3.7%)8.5%3.6%3.4% 11.5% 14.0%0.8%
ALL OTHER GOV'T FUNDS
Nonspendable 542,619 1,938,628 250,970 250,290 227,197 221,019 227,706 266,408 298,312 276,872 Restricted 23,065,276 10,891,614 11,676,546 7,680,713 11,577,849 13,330,982 20,224,326 26,854,736 15,106,171 12,965,377
Assigned 28,510,594 22,935,181 19,799,434 25,270,027 25,215,825 24,996,835 31,958,975 34,757,827 36,717,748 43,515,281
Unassigned (6,295,915) (6,572,969) (5,110,657) (2,587,713) (4,512,314) (2,218,785) (3,741,963) (2,227,264) (1,458,107) (563,794)
Subtotal All Other Govt' Funds 45,822,574 29,192,454 26,616,293 30,613,317 32,508,557 36,330,051 48,669,044 59,651,707 50,664,124 56,193,736
TOTAL GOVT' FUNDS
Nonspendable 582,463 1,961,575 286,762 280,327 331,042 290,630 322,530 453,786 478,908 386,448
Restricted 23,065,276 10,891,614 11,963,488 7,680,713 11,577,849 13,342,130 20,234,898 26,854,736 15,106,171 12,965,377 Assigned 28,510,594 22,935,181 19,799,434 25,270,027 25,215,825 24,996,835 31,958,975 34,757,827 36,717,748 43,515,281
Unassigned 15,996,272 16,286,841 18,060,661 20,004,447 19,926,375 23,135,939 22,455,466 26,905,271 31,793,982 33,043,297
Total Govt' Funds $68,154,605 $52,075,211 $50,110,345 $53,235,514 $57,051,091 $61,765,534 $74,971,869 $88,971,620 $84,096,809 $89,910,403
All Govt' Funds % Change 1.2% (23.6%) (3.8%)6.2%7.2%8.3% 21.4% 18.7% (5.5%)6.9%
163
City of Eden Prairie, Minnesota Changes in Fund Balances-Governmental Funds (modified accrual basis of accounting) Last Ten Years
SOURCE 2014 2015 2016 2017 2018 2019 2020 2021 2022 2023
REVENUES
Taxes and Special Assessments $37,189,846 $44,259,324 $41,169,891 $42,262,252 $42,826,126 $42,964,367 $44,264,894 $46,176,740 $46,337,423 $47,888,864 Licenses and Permits 7,084,975 6,686,477 6,017,523 5,810,945 7,938,046 9,054,415 8,351,257 9,207,247 8,639,380 9,857,421
Intergovernmental Revenue 8,582,993 6,299,840 2,362,417 7,787,877 2,980,678 14,691,473 10,676,031 11,176,877 13,417,354 7,687,714 Charges for Services 4,841,857 4,864,818 5,325,932 5,744,494 5,976,951 6,132,338 2,464,886 5,680,570 7,128,820 7,071,359
Fines and Forfeits 406,210 344,384 346,823 347,285 416,028 370,944 231,166 323,965 297,682 351,891 Investment Income 216,895 276,176 417,997 310,433 887,536 1,523,825 1,458,094 (279,195) (1,264,760) 3,375,808
Lease Income - - - - - - - - 88,712 120,119 Miscellaneous Revenue 1,647,534 7,098,463 3,249,117 2,835,760 4,853,894 4,684,221 5,166,785 2,519,176 2,113,950 1,220,399
Total Revenues 59,970,310 69,829,482 58,889,700 65,099,046 65,879,259 79,421,583 72,613,113 74,805,380 76,758,561 77,573,575
EXPENDITURES
Administration 3,946,531 3,809,732 4,280,665 4,036,821 4,467,514 4,455,624 4,547,110 4,652,491 5,299,977 5,523,671
Community Development 5,224,034 7,666,282 5,536,030 6,102,434 5,143,042 4,762,403 4,975,185 5,399,337 5,822,510 5,682,164
Police 13,079,303 13,704,796 13,917,677 14,183,797 14,672,312 15,354,150 15,537,807 16,332,800 17,306,528 18,116,124
Fire 5,664,111 5,754,747 5,699,308 6,145,202 6,058,619 5,854,829 6,378,338 6,421,157 6,841,419 6,760,050
Public Works 5,915,849 5,869,727 5,929,171 6,194,054 5,997,312 6,010,535 6,090,297 6,207,912 6,640,329 6,853,256 Parks and Recreation 10,255,620 10,571,858 11,008,845 11,309,009 12,176,110 12,629,951 11,137,410 12,360,785 13,684,180 14,506,140
Capital Outlay 21,000,674 31,265,363 15,133,476 8,779,760 9,816,539 24,076,873 13,411,943 12,224,168 14,365,404 13,844,146 Miscellaneous 25,547 39,283 49,954 40,019 66,154 65,245 98,137 - - -
Debt ServicePrincipal 3,178,107 3,974,224 3,415,369 5,657,828 3,869,824 3,436,793 3,743,793 4,956,848 2,696,989 2,581,686
Interest 1,127,862 1,304,947 1,148,544 1,068,403 975,631 895,435 815,351 688,156 578,520 458,020 Other 144,530 22,517 66,043 23,500 16,848 10,838 64,875 137,719 8,733 5,099
Total Expenditures 69,562,168 83,983,476 66,185,082 63,540,827 63,259,905 77,552,676 66,800,246 69,381,373 73,244,589 74,330,356
Excess of Revenues Over
(Under) Expenditures (9,591,858) (14,153,994) (7,295,382) 1,558,219 2,619,354 1,868,907 5,812,867 5,424,007 3,513,972 3,243,219
Other Financing Sources (Uses)10,380,621 (1,925,400) 5,330,516 1,566,950 1,196,223 2,845,536 7,393,468 8,575,744 (8,388,783) 2,570,375
Net Change in Fund Balance $788,763 $(16,079,394) $(1,964,866) $3,125,169 $3,815,577 $4,714,443 $13,206,335 $13,999,751 $(4,874,811) $5,813,594
Debt Service as a % of
Noncapital Expenditures 7.5%7.9%8.1% 11.4%8.0%6.4%7.2%8.3%4.7%4.5%
164
City of Eden Prairie, Minnesota Assessed/Tax Capacity Value and Estimated Market Value of Property Last Ten Years
Tax Tax Capacity Less: Less:Total Total Estimated Annual
Payable Personal Commercial Farm &Before Fiscal Tax Assessed Direct Market %
Dec. 31 Property Residential Apartments & Industrial Other Deductions Disparities Increment Value Tax Rate Value Change
2014 $1,536,795 $59,699,056 $6,723,391 $37,928,219 $75,620 $105,963,081 $14,732,733 $3,137,785 $88,092,563 $34.709 $8,627,122,700 1.7%2015 1,581,718 63,907,631 7,045,373 38,765,135 49,597 111,349,454 15,719,259 2,933,721 92,696,474 33.954 9,078,339,200 5.2%
2016 1,659,596 68,205,510 7,667,144 40,928,173 45,052 118,505,475 15,104,618 3,126,571 100,274,286 32.327 9,633,243,700 6.1%
2017 1,778,971 69,180,068 8,887,941 41,710,414 44,200 121,601,594 16,281,768 3,209,405 102,110,421 32.667 9,872,802,500 2.5%
2018 1,317,656 72,149,265 9,758,671 41,957,995 43,813 125,227,400 16,415,817 2,208,824 106,602,759 32.526 10,209,614,900 3.4%
2019 1,995,250 75,815,471 10,394,693 42,523,027 44,602 130,773,043 16,343,594 1,869,603 112,559,846 31.690 10,663,264,100 4.4%2020 1,947,874 79,500,899 11,243,928 43,474,992 46,519 136,214,212 17,538,211 2,121,042 116,554,959 31.676 11,121,835,000 4.3%2021 2,051,756 80,291,885 12,786,587 45,576,586 46,926 140,753,740 17,487,960 2,669,795 120,595,985 31.589 11,432,806,600 2.8%
2022 1,161,844 83,981,033 13,846,793 45,217,108 47,063 144,253,841 18,644,565 2,767,772 122,841,504 32.475 11,797,011,500 3.2%
2023 1,261,919 101,477,516 14,702,244 46,666,073 47,873 164,155,625 17,627,603 2,847,499 143,680,523 29.039 13,485,585,500 14.3%
2014 1.5%56.3%6.3%35.8%0.1%16.7%3.6%2015 1.4%57.4%6.3%34.8%0.0%17.0%3.2%2016 1.4%57.6%6.5%34.5%0.0%15.1%3.1%
2017 1.5%56.9%7.3%34.3%0.0%15.9%3.1%
2018 1.1%57.6%7.8%33.5%0.0%15.4%2.1%
2019 1.5%58.0%7.9%32.5%0.0%14.5%1.7%
2020 1.4%58.4%8.3%31.9%0.0%15.0%1.8%2021 1.5%57.0%9.1%32.4%0.0%14.5%2.2%2022 0.8%58.2%9.6%31.3%0.0%15.2%2.3%
2023 0.8%61.8%9.0%28.4%0.0%12.3%2.0%
Source: City Assessing Department and Hennepin County
Percentages
Tax Capacity
165
City of Eden Prairie, Minnesota Direct and Overlapping Property Tax Rate Last Ten Years
Year Total School School School Watershed Watershed Watershed
Ended City HRA City Hennepin Special District District District District District District
Dec. 31 Rate Rate Rate County Districts (1)#270 #272 #276 #1 #2 #4
2014 34.493 0.216 34.709 49.959 10.561 32.358 27.817 24.374 1.490 0.759 1.880
2015 33.749 0.205 33.954 46.398 9.785 30.340 22.030 25.093 1.315 0.686 1.855
2016 32.137 0.190 32.327 45.356 9.530 28.514 20.948 22.887 1.233 0.598 1.745
2017 32.480 0.187 32.667 44.087 9.319 25.611 21.865 22.770 1.257 0.718 1.992
2018 32.348 0.178 32.526 42.808 8.973 29.035 20.525 23.133 1.204 0.659 2.269
2019 31.521 0.169 31.690 41.861 8.550 27.022 20.756 21.209 1.164 0.527 2.204
2020 31.513 0.163 31.676 41.084 8.219 27.190 21.555 21.167 1.111 0.574 2.160
2021 31.432 0.157 31.589 38.210 7.813 26.478 21.717 20.923 1.020 0.550 1.992
2022 32.322 0.153 32.475 38.535 7.849 26.783 20.995 21.002 0.981 0.541 1.968
2023 28.904 0.135 29.039 34.542 6.944 25.006 19.243 17.720 0.935 0.480 1.757
Year City School School School
Ended Direct District District District
Dec. 31 Rate #270 #272 #276
2014 0.0122 0.197 0.167 0.270
2015 0.0100 0.179 0.244 0.264
2016 0.0091 0.187 0.231 0.301
2017 0.0089 0.180 0.220 0.300
2018 0.0086 0.150 0.229 0.303
2019 0.0080 0.147 0.222 0.340
2020 0.0077 0.162 0.209 0.339
2021 0.0077 0.144 0.201 0.325
2022 0.0077 0.140 0.205 0.312
2023 0.0068 0.150 0.216 0.307
(1) Special Districts include Metropolitan Council, Regional Transit Board, Metropolitan Mosquito Control, County Park Museum, &
Hennepin Suburban Parks
Market Value Rates
Overlapping Rates
Tax Capacity Rates
Direct Rates
Overlapping Rates
166
City of Eden Prairie, Minnesota Principal Property Taxpayers For the Year Ended December 31, 2023 and 2014
Percentage Percentage
Tax of Total Tax of Total
Taxpayer Capacity Tax Capacity Taxpayer Capacity Tax Capacity
United Healthcare $2,557,030 1.6%Liberty Property Limited Partnership $2,509,100 2.4%
Arrive Eden Prairie Apartments 1,106,350 0.7%Eden Prairie Mall LLC 2,503,440 2.4%
Fountain Place Apartments 1,100,489 0.7%AGNL Health 1,394,430 1.3%
Eden Prairie Mall 1,092,450 0.7%CPE Holding 32607 LLC, Etal 815,130 0.8%
Elevate Apartments 908,585 0.6%PRIT Core Realty Holdings LLC 747,088 0.7%
Flagstone-Presbyterian Homes 881,438 0.5%United Healthcare Serv Inc 629,250 0.6%
UHG Headquarters 807,250 0.5%Lifetouch Inc.594,962 0.6%
Flying Cloud Corporate Campus 775,620 0.5%Gelco Corp.559,740 0.5%
Park at City West Apartments 686,909 0.4%Windsor Plaza LLC 536,298 0.5%
Arrive Watertower Apartments 677,845 0.4%IRET Properties 472,660 0.4%
Total Principal Taxpayers 10,593,966 6.5%10,762,098 10.2%
All Other Taxpayers 153,561,659 93.5%95,200,983 89.8%
Total $164,155,625 100.0%$105,963,081 100.0%
Source: City of Eden Prairie Assessing Department
2023 2014
167
City of Eden Prairie, Minnesota Property Tax Levies and Collections Last Ten Years
Collected Within the
Year Current Year Levy Collections Total Collections to Date
Ended Taxes % of in Subsequent % of
Dec. 31 Levied Amount Levy Years Amount Levy
2014 $33,220,111 $32,881,280 98.98%$(25,563) $32,855,717 98.90%
2015 33,992,311 33,675,337 99.07% (121,190) 33,554,147 98.71%
2016 34,860,874 34,512,035 99.00% (334,699) 34,177,336 98.04%
2017 35,911,841 35,480,742 98.80% (223,399) 35,257,343 98.18%
2018 37,349,820 37,319,709 99.92% (49,207) 37,270,503 99.79%
2019 38,478,724 38,167,003 99.19% (41,107) 38,125,896 99.08%
2020 39,821,102 39,406,040 98.96% (35,815) 39,370,225 98.87%
2021 41,214,490 40,801,607 99.00% 114,887 40,916,494 99.28%
2022 43,302,554 42,959,885 99.21% (172,868) 42,787,017 98.81%
2023 45,114,284 44,679,780 99.04% (90,383) 44,589,397 98.84%
Source: Hennepin County
168
City of Eden Prairie, Minnesota Legal Debt Margin Last Ten Years
2014 2015 2016 2017 2018 2019 2020 2021 2022 2023
Estimated Market Value $8,627,122,700 $9,078,339,200 $9,633,243,700 $9,872,802,500 $10,209,614,900 $10,663,264,100 $11,121,835,000 $11,432,806,600 $11,797,011,500 $13,485,585,500
Legal Debt Margin: Debt Limit: 3% of Market Value 258,813,681 272,350,176 288,997,311 296,184,075 306,288,447 319,897,923 333,655,050 342,984,198 353,910,345 404,567,565
Amount of Debt Applicable to Debt Limit:General Obligation Bonds 17,906,759 13,499,232 12,036,705 10,648,354 9,211,190 8,191,241 13,227,541 4,891,000 3,673,000 2,455,000 Tax Abatement Bonds 17,598,269 17,575,537 17,552,806 17,180,074 16,697,342 16,229,610 15,306,879 27,653,135 13,168,934 12,303,881 Deductions:
Amt Available for Repayment
of Bonds (1)1,715,750 2,032,109 2,303,895 2,336,132 2,296,320 2,682,004 8,730,968 14,651,101 1,407,790 1,659,490 Total Debt Applicable to Limit 33,789,278 29,042,660 27,285,616 25,492,296 23,612,212 21,738,847 19,803,452 17,893,034 15,434,144 13,099,391
Legal Debt Margin $225,024,403 $243,307,516 $261,711,695 $270,691,779 $282,676,235 $298,159,076 $313,851,598 $325,091,164 $338,476,201 $391,468,174
As a % of Debt Limit 86.9%89.3%90.6%91.4%92.3%93.2%94.1%94.8%95.6%96.8%
1 - Amt Available for Repayment of Bonds only includes "Restricted Debt" of General Obligation and Tax Abatement Bonds
169
City of Eden Prairie, Minnesota Ratios of Outstanding Debt by Type Last Ten Years
Special
Year General Tax Total General Lease Assessments Total Total Percentage
Ended Obligation Abatement Bonded Revenue Improvement Finances Lease Subscription Govt'Revenue Lease Business-of Personal Per
Dec. 31 Bonds Bonds Debt Bonds Bonds Purchases Liability Liability Bonds Bonds Liability Type Total Income (1)Capita (2)
2014 $17,906,759 $17,598,269 $35,505,028 $1,290,000 $14,834,596 $89,593 $ - $- $51,719,217 $2,927,476 $ - $2,927,476 $54,646,693 1.73%871
2015 13,499,232 17,575,537 31,074,769 1,220,000 12,289,647 45,369 - - 44,629,785 2,466,230 - 2,466,230 47,096,015 1.425%752 2016 12,036,705 17,552,806 29,589,511 1,145,000 12,799,455 286,942 - - 43,820,908 3,631,427 - 3,631,427 47,452,335 1.38%751
2017 10,648,354 17,180,074 27,828,428 - 10,021,959 231,734 - - 38,082,121 3,143,967 - 3,143,967 41,226,088 1.14%653 2018 9,211,190 16,697,342 25,908,532 - 8,054,154 175,457 - - 34,138,143 2,511,507 - 2,511,507 36,649,650 1.01%575 2019 8,191,241 16,229,610 24,420,851 - 6,101,720 118,090 - - 30,640,661 6,960,748 - 6,960,748 37,601,409 1.01%593
2020 13,227,541 15,306,879 28,534,420 - 4,320,627 59,611 - - 32,914,658 6,088,767 - 6,088,767 39,003,425 1.05%612 2021 4,891,000 27,653,135 32,544,135 - 2,606,494 - - - 35,150,629 11,674,835 - 11,674,835 46,825,464 1.18%729 2022 3,673,000 13,168,934 16,841,934 - 2,110,026 418,137 98,441 - 19,468,538 11,272,267 1,314,339 12,586,606 32,055,144 0.74%500 2023 2,455,000 12,303,881 14,758,881 - 1,608,762 325,937 75,603 842,087 17,611,270 10,599,698 1,150,738 11,750,436 29,361,706 *459
(1) See Demographic and Economic Statistics for personal income(2) See Demographic and Economic Statistics for population* Information is not available
Governmental Activities Activities
Business-Type
170
City of Eden Prairie, Minnesota Ratios of General Bonded Debt Outstanding Last Ten Years
Total Net Ratio of Net
Year General Tax General Less Amounts General Bonded Debt
Ended Obligation Abatement Bonded Available in Debt Bonded to Estimated Per
Dec. 31 Debt (1)Bonds Debt Service Fund (1)Debt Market Value (2) Capita (3)
2014 $17,906,759 $17,598,269 $35,505,028 $1,715,750 $33,789,278 0.39% 539
2015 13,499,232 17,575,537 31,074,769 2,032,109 29,042,660 0.32% 464
2016 12,036,705 17,552,806 29,589,511 2,303,895 27,285,616 0.28% 432
2017 10,648,354 17,180,074 27,828,428 2,336,132 25,492,296 0.26% 404
2018 9,211,190 16,697,342 25,908,532 2,296,320 23,612,212 0.23% 371
2019 8,191,241 16,229,610 24,420,851 2,682,004 21,738,847 0.20% 343
2020 13,227,541 15,306,879 28,534,420 8,730,968 19,803,452 0.18% 311
2021 4,891,000 27,653,135 32,544,135 14,651,101 17,893,034 0.16% 279
2022 3,673,000 13,168,934 16,841,934 1,407,790 15,434,144 0.13% 241
2023 2,455,000 12,303,881 14,758,881 1,659,490 13,099,391 0.10% 205
(1) Amount Does not Include Special Assessment Improvement or Revenue Bonds.
(2) See "Taxable Assessed Value and Estimated Actual Value of Property" for Market Value
(3) See Demographic and Economic Statistics for Population
171
City of Eden Prairie, Minnesota Computation of Direct and Overlapping Bonded Debt December 31, 2023
Percent
of Debt Net Debt
Debt Applicable Applicable
Governmental Unit Outstanding to City (1)to City
Direct Debt:
City of Eden Prairie $17,611,270 100.00%$16,792,874
Overlapping Debt:
Hopkins ISD 270 $139,056,123 4.28%$5,951,602
Eden Prairie ISD 272 98,606,125 97.54%96,180,414
Minnetonka ISD 276 117,165,256 2.74%3,210,328
Hennepin County 1,056,334,526 5.82%61,478,669
Henn Suburban Park District 49,655,074 8.02%3,982,337
Henn Regional RR Authority 80,622,443 5.82%4,692,226
Metropolitan Council 89,723,130 2.88%2,584,026
Total Overlapping Debt 1,631,162,677 178,079,602
Total Direct and
Overlapping Debt $1,648,773,947 $194,872,476
Notes:
1- The percentage of overlapping debt applicable is estimated using taxable assessed
property values. Applicable percentages were estimated by determining the portion of the
county's taxable assessed value that is within the City's boundaries and dividing it by the
county's total taxable assessed value.
172
City of Eden Prairie, Minnesota Demographic and Economic Statistics Last Ten Years
Per
Personal Capita Median School Unemployment
Year Population Income Income Age Enrollment Rate
2014 62,729 3,163,737,115$ 50,435$ 37.90 9,011 3.3%
2015 62,593 3,306,037,074 52,818 38.30 8,941 2.9%
2016 63,187 3,450,073,387 54,601 39.70 8,844 2.9%
2017 63,163 3,609,007,494 57,138 40.20 8,835 2.7%
2018 63,726 3,624,097,620 56,870 39.40 8,780 2.3%
2019 63,456 3,735,654,720 58,870 39.40 8,861 2.5%
2020 63,726 3,719,877,798 58,373 40.20 8,759 5.3%
2021 64,198 3,963,584,520 61,740 39.70 8,534 3.0%
2022 64,142 4,309,251,986 67,183 39.50 8,748 2.0%
2023 64,023 ***8,834 2.4%
Sources:
City of Eden Prairie Planning Department
Minnesota Department of Employment and Economic Development
United States Census Bureau
Eden Prairie School District 272 - Enrollment History Website
* Data is not available
Governmental Activities
173
City of Eden Prairie, Minnesota Principal Employers For the Year Ended December 31, 2023 and 2014
Percentage Percentage
of Total of Total
Employer Employees City Employment Employer Employees City Employment
Optum 3,312 5.7% Optum 4,400 8.7%
Eden Prairie Mall 2,329 4.0%Starkey Labs 2,000 4.0%
EP Schools 2,329 4.0%EP Schools 1,583 3.1%
CH Robinson 2,200 3.8%CH Robinson 1,536 3.0%
United Natural Foods Inc.2,000 3.5%Rosemount - Emerson 1,500 3.0%
Starkey Labs 1,500 2.6%SuperValu Stores Inc.1,100 2.2%
Emerson Process Management 1,500 2.6% Cigna 950 1.9%
Tennant Company 1,500 2.6%Eaton Corp.850 1.7%
Element Fleet Management 1,200 2.1%MTS Systems Corp.833 1.6%
MTS Systems 1,000 1.7%Kroll On-Track 808 1.6%
Total Principal Employer 18,870 32.7%15,560 30.8%
Other Employers 38,776 67.3%35,034 69.2%
Total Employers 57,646 100.0%50,594 100.0%
Source: Official Bonds Statement for G.O. Water Revenue Bonds, Series 2021A
2023 2014
174
City of Eden Prairie, Minnesota Employees by Function Last Ten Years
2014 2015 2016 2017 2018 2019 2020 2021 2022 2023
Administration
Office of City Manager 2 2 2 2 2 2 2 2 2 2
City Clerk 1 1 1 1 1 1 2 2 1 1
Human Resources 9.7 9.7 9.8 9.8 9.8 9.8 9.8 9.8 9.8 9.8
Communications 3.5 3.5 3.5 3.5 3.5 3.5 3.5 3.5 3.5 3.5
Finance 5.5 5.5 5.5 5.5 5.5 5.5 5.5 5.5 5.5 5.5
Liquor Stores 9 9 9 9 9 9 9 9 9 9
Information Technology 7 7 6 6 6 6 6 6.5 6.5 6.5
Facilities 9.88 9.88 9.88 10 10 10 10 10 10 10
Community Development
Administration 2 2 2 2 2 2 2 2 2 2
Assessing 7 7 7 7 7 7 7 7 7 7
Planning 4.6 4.7 4.7 4.7 4.7 4.7 4.8 4.8 5 5
Economic Development 1 1 1 1 1 1 1 1 1 1
Housing & Community Services 1.75 1.75 1.75 1.75 1.75 2 2 2 2 2
Parks and Recreation
Administration 2 2 2 2 2 2 2 2 2 2
Park Maintenance 20 20 20 20 20 20 20 20 21 21
Recreation Services 7.6 7.6 7.6 7.6 7.6 7.6 7.6 7.6 7.6 7.6
Community Center 5.5 5.5 6.5 6.5 6.5 6.5 6.5 6.5 6.5 6.5
Police
Professional Staff 25 25 25 25 25 24 24 24 25 25
Sworn Officers 66 66 67 68 68 69 69.5 70.5 71 72
Fire
Administration 9 9 9 9 9 9 9 9 11 11
Building Inspections 9 9 9 9 9 9 9 9 9 9
Public Works
Engineering 8.3 9.3 10.3 10.3 7.5 7.5 7.5 7.5 7.5 7.5
Street Maintenance 14.5 14.5 14 14 14 15 15 15 15 15
Utilities 34.7 34.7 35.7 35.7 39.5 39.5 39.5 39.5 40 39.5
Fleet Services 6.5 5.5 5 5 5 5 5 5 5 5
Grand Total 272.03 272.13 274.23 275.35 276.35 277.6 279.2 280.7 284.9 285.4
Source: Human Resource department
175
City of Eden Prairie, Minnesota Operating Indicators Last Ten Years
2014 2015 2016 2017 2018 2019 2020 2021 2022 2023
General Government
Bond Rating - Moody's Investor Service Aaa Aaa Aaa Aaa Aaa Aaa Aaa Aaa Aaa Aaa
Bond Rating - Standard & Poors AAA AAA AAA AAA AAA AAA AAA AAA AAA AAA
Housing and Human ServicesNumber of Residents Served 3,500 3,500 3,500 3,750 3,975 5,700 9,200 14,300 6,105 5,050
Assessing:
Number of Inspections Completed 5,291 5,320 5,066 5,061 4,908 4,912 5,267 4,842 5,195 5,116
Parks and Recreation
Avg Monthly Community Center Memberships n/a n/a 2,511 2,688 2,608 2,486 1,683 1,346 1,744 1,954 Program Registrations (Excludes Leagues)18,269 17,531 15,701 17,161 17,972 19,931 6,022 14,848 15,877 17,643
Public Safety
Fire
Number of Calls 1,614 1,617 1,615 1,742 1,908 1,875 2,915 2,909 3,426 3,272
Inspection Permits Issued 7,469 6,405 5,997 6,227 6,436 6,438 7,766 8,883 7,117 6,603 Building permit revenue 3,496,417$ 3,059,075$ 2,303,405$ 2,066,787$ 3,388,529$ 3,646,332$ 3,578,799$ 4,409,481$ 3,836,375$ 3,562,908$
Police
Number of Calls 50,380 49,921 50,741 46,319 52,278 50,909 40,564 42,801 43,363 45,765
Public Works:
Patching Materials (Tons)2,400 1,555 2,370 1,650 1,700 1,976 1,739 1,164 1,019 1,140
Overlays (Tons)26,488 29,602 23,070 28,856 29,852 31,503 35,988 33,164 45,456 39,484
Crack Filling Materials (Lbs)154,944 32,000 68,000 42,000 31,920 50,007 66,175 6,340 34,570 36,432
Seal Coating (Sq Yards) - Chips Sealed Placed 375,500 411,700 381,600 405,425 365,907 327,998 364,854 66,892 N/A N/A
Seal Coating (Sq Yards) - Fog Seal/Reclamite Placed n/a n/a n/a n/a n/a 276,296 470,020 602,335 502,598 259,820
Water System:
Number of Connections 19,269 19,312 19,362 19,426 19,426 19,426 19,541 19,526 19,568 19,598 Water Main Repairs 9 28 53 30 18 24 33 24 27 36
Number of Hydrant Flushed 4,326 4,311 4,515 4,360 4,395 4,274 - 4,273 4,470 4,476
Average Daily Usage 7.25 MGD 6.99 MGD 7.07 MGD 7.06 MGD 7.08 MG 6.25 MG 6.95 MG 7.72 MG 7.4 MG 7.6 MGD
Sewer System:
Number of Connections 18,578 18,644 18,707 18,865 18,925 18,955 19,016 19,022 19,072 19,096 Miles of Sanitary Sewer Cleaned 75 81 81 76 65 50 10 51 65 86
Storm System:
Number of Storm Sumps Maintained 103 78 91 88 97 48 40 60 52 143
Sources: Various City Departments
MGD - Million Gallons Daily
N/A - Not Available
176
City of Eden Prairie, Minnesota Capital Assets Statistics by Function Last Ten Years
2014 2015 2016 2017 2018 2019 2020 2021 2022 2023
Public Safety
Fire Protection
Number of Stations 4 4 4 4 4 4 4 4 4 4
Number of Volunteer Firefighters 90 92 99 101 95 92 94 93 95 92
Police Protection
Number of Stations 1 1 1 1 1 1 1 1 1 1
Public Works
Miles of City Streets 233 234 234 234 235 235 235 236 235 235
Parks and Recreation
City Parks 43 43 43 43 43 43 43 43 43 43
Conservation Areas 15 15 15 15 15 15 15 15 15 15
Historic Sites 5 5 5 5 5 5 5 5 5 5
Special Use Areas 5 5 5 5 5 5 5 5 5 5
Miles of Trails 128 128 128 134 134 134.5 134.5 134.5 134.5 134.5
Water System
Number of Wells 15 15 15 15 15 15 15 15 15 15
Total Pumping Capacity 28 MGD 28 MGD 28 MGD 28 MGD 28 MGD 28 MGD 28 MGD 28 MGD 28 MGD 28 MGD
Total Storage Capacity 8.5 MG 8.5 MG 8.5 MG 8.5 MG 8.5 MG 8.5 MG 12.5 MG 12.5 MG 12.5 MG 12.5 MG
Miles of Water Mains 326 326 328 326 326 327 326 322 399 408
Sewer System
Miles of Sanitary Sewer 262 264 264 263 263 264 265 262 262 334
Miles of Storm Sewer 186 189 193 193 193 195 198 200 209 207
Sources: Various City Departments
Note: No Capital Asset Indicators are Available for the General Government Functions.
MGD - Million Gallons Daily
177
City of Eden Prairie
Hennepin County, Minnesota
Schedule of Expenditures of
Federal Awards and
Independent Auditor's Reports
December 31, 2023
City of Eden Prairie
Table of Contents
Schedule of Expenditures of Federal Awards 1
Notes to Schedule of Expenditures of Federal Awards 2
Report on Internal Control over Financial Reporting and on Compliance and
Other Matters Based on an Audit of Financial Statements Performed in
Accordance with Government Auditing Standards 3
Report on Compliance for Each Major Federal Program and Report on Internal Control
over Compliance in Accordance with the Uniform Guidance 5
Schedule of Findings and Questioned Costs 8
Minnesota Legal Compliance 10
See notes to schedule of expenditures of federal awards. 1
Federal
Expenditures
U.S. Department of Housing and Urban Development
Direct
Community Development Block Grant Program 14.218 621,585$
U.S. Department of Transportation
Passed through Minnesota Department of Public Safety
Passed through Metropolitan Airport Commission
State and Community Highway Safety - Enforcement Wave Plan (Safe and Sober) 20.600 38,154
Passed through Minnesota Department of Public Safety
Passed through Metropolitan Airport Commission
State and Community Highway Safety - Seat Belt 20.616 9,771
Passed through Minnesota Department of Public Safety
Passed through Metropolitan Airport Commission
Minimum Penalties for Repeat Offenders for Driving While Intoxicated 20.608 156,660
Total U.S. Department of Transportation 204,585
U.S. Department of Justice
Direct
Bulletproof Vest Partnership Program 16.607 9,378
U.S. National Park Service
Passed through State of Minnesota Admin Fiscal Services
Historic Preservation Fund Grants-In-Aid 15.904 460
Center for Disease Control and Prevention
Passes through Minnesota Department of Health
Assistance Programs for Chronic Disease Prevention and Control 93.945 4,326
Total Federal Expenditures 840,334$
Federal Agency/Pass Through Agency/Program Title
City of Eden Prairie
Schedule of Expenditures of Federal Awards
Year Ended December 31, 2023
Federal
Assistance
Listing Number
2
City of Eden Prairie
Notes to Schedule of Expenditures of Federal Awards
NOTE 1 – BASIS OF PRESENTATION
The accompanying Schedule of Expenditures of Federal Awards (the “Schedule”) includes the federal
award activity of the City under programs of the federal government for the year-ended
December 31, 2023. The information in this Schedule is presented in accordance with the
requirements of Title 2 U.S. Code of Federal Regulations Part 200, Uniform Administrative
Requirements, Cost Principles, and Audit Requirements for Federal Awards (Uniform Guidance).
Because the Schedule presents only a selected portion of the operations of the City, it is not
intended to and does not present the financial position, changes in net position, or cash flows of the
City.
NOTE 2 – SUMMARY OF SIGNIFICANT ACCOUNTING POLICIES
Expenditures reported on the Schedule are reported on the modified accrual basis of accounting.
Such expenditures are recognized following the cost principles contained in the Uniform Guidance,
wherein certain types of expenditures are not allowable or are limited as to reimbursement.
NOTE 3 – PASS-THROUGH GRANT NUMBERS
All pass-through entities listed above use the same Assistance Listing numbers as the federal grantors
to identify these grants and have not assigned any additional identifying numbers.
NOTE 4 – INDIRECT COST RATE
The City has not elected to use the 10 percent de minimis indirect cost rate, as allowed under the
Uniform Guidance.
3
Report on Internal Control over Financial Reporting
and on Compliance and Other Matters Based on an Audit of
Financial Statements Performed in Accordance with
Government Auditing Standards
Independent Auditor's Report
Honorable Mayor and Members
of the City Council
City of Eden Prairie
Eden Prairie, Minnesota
We have audited, in accordance with auditing standards generally accepted in the United States of
America and the standards applicable to financial audits contained in Government Auditing
Standards issued by the Comptroller General of the United States, the financial statements of the
governmental activities, the business-type activities, each major fund, and the aggregate remaining
fund information of the City of Eden Prairie, Minnesota, as of and for the year ended December 31,
2023, and the related notes to the basic financial statements, which collectively comprise the City's
basic financial statements, and have issued our report thereon dated April 22, 2024.
Report on Internal Control over Financial Reporting
In planning and performing our audit of the financial statements, we considered the City's internal
control over financial reporting (internal control) as a basis for designing audit procedures that are
appropriate in the circumstances for the purpose of expressing our opinions on the financial
statements, but not for the purpose of expressing an opinion on the effectiveness of the City's
internal control. Accordingly, we do not express an opinion on the effectiveness of the City's internal
control.
A deficiency in internal control exists when the design or operation of a control does not allow
management or employees, in the normal course of performing their assigned functions, to prevent,
or detect and correct, misstatements on a timely basis. A material weakness is a deficiency, or a
combination of deficiencies, in internal control such that there is a reasonable possibility that a
material misstatement of the City's financial statements will not be prevented, or detected and
corrected, on a timely basis. A significant deficiency is a deficiency, or a combination of
deficiencies, in internal control that is less severe than a material weakness, yet important enough
to merit attention by those charged with governance.
Our consideration of internal control was for the limited purpose described in the first paragraph of
this section and was not designed to identify all deficiencies in internal control that might be
material weaknesses, or significant deficiencies. Given these limitations, during our audit we did not
identify any deficiencies in internal control that we consider to be material weaknesses. However,
material weaknesses may exist that have not been identified.
Report on Compliance and Other Matters
As part of obtaining reasonable assurance about whether the City's financial statements are free
from material misstatement, we performed tests of its compliance with certain provisions of laws,
regulations, contracts, and grant agreements, noncompliance with which could have a direct and
material effect on the financial statements.
4
Report on Compliance and Other Matters (Continued)
However, providing an opinion on compliance with those provisions was not an objective of our
audit, and accordingly, we do not express such an opinion. The results of our tests disclosed no
instances of noncompliance or other matters that are required to be reported under Government
Auditing Standards.
Purpose of this Report
The purpose of this report is solely to describe the scope of our testing of internal control and
compliance and the result of that testing, and not to provide an opinion on the effectiveness of the
City's internal control or on compliance. This report is an integral part of an audit performed in
accordance with Government Auditing Standards in considering the City's internal control and
compliance. Accordingly, this communication is not suitable for any other purpose.
St. Cloud, Minnesota
April 22, 2024
5
Report on Compliance for each Major Federal Program
and Report on Internal Control over Compliance in Accordance with
the Uniform Guidance
Independent Auditor's Report
Honorable Mayor and Members
of the City Council
City of Eden Prairie
Eden Prairie, Minnesota
Report on Compliance for Each Major Federal Program
Opinion on Each Major Federal Program
We have audited the City of Eden Prairie's compliance with the types of compliance requirements
identified as subject to audit in the OMB Compliance Supplement that could have a direct and
material effect on the City's major federal program for the year ended December 31, 2023. The City's
major federal program is identified in the summary of auditor's results section of the accompanying
Schedule of Findings and Questioned Costs.
In our opinion, the City complied in all material respects, with the compliance requirements referred
to above that could have a direct and material effect on its major federal program for the year
ended December 31, 2023.
Basis for Opinion on Each Major Federal Program
We conducted our audit of compliance in accordance with auditing standards generally accepted in
the United States of America (GAAS); the standards applicable to financial audits contained in
Government Auditing Standards issued by the Comptroller General of the United States (Government
Auditing Standards); and the audit requirements of Title 2 U.S. Code of Federal Regulations Part
200, Uniform Administrative Requirements, Cost Principles, and Audit Requirements for Federal
Awards (Uniform Guidance). Our responsibilities under those standards and the Uniform Guidance are
further described in the Auditor's Responsibilities for the Audit of Compliance section of our report.
We are required to be independent of the City and to meet our other ethical responsibilities, in
accordance with relevant ethical requirements relating to our audit. We believe that the audit
evidence we have obtained is sufficient and appropriate to provide a basis for our opinion on
compliance for each major federal program. Our audit does not provide a legal determination of the
City's compliance with the compliance requirements referred to above.
Responsibilities of Management for Compliance
Management is responsible for compliance with the requirements referred to above and for the
design, implementation, and maintenance of effective internal control over compliance with the
requirements of laws, statutes, regulations, rules and provisions of contracts or grant agreements
applicable to the City's federal programs.
6
Auditor's Responsibilities for the Audit of Compliance
Our objectives are to obtain reasonable assurance about whether material noncompliance with the
compliance requirements referred to above occurred, whether due to fraud or error, and express an
opinion on the City's compliance based on our audit. Reasonable assurance is a high level of
assurance but is not absolute assurance and therefore is not a guarantee that an audit conducted in
accordance with GAAS, Government Auditing Standards, and the Uniform Guidance will always
detect material noncompliance when it exists. The risk of not detecting material noncompliance
resulting from fraud is higher than for that resulting from error, as fraud may involve collusion,
forgery, intentional omissions, misrepresentations, or the override of internal control.
Noncompliance with the compliance requirements referred to above is considered material, if there
is a substantial likelihood that, individually or in the aggregate, it would influence the judgment
made by a reasonable user of the report on compliance about the City's compliance with the
requirements of each major federal program as a whole.
In performing an audit in accordance with GAAS, Government Auditing Standards, and the Uniform
Guidance, we:
Exercise professional judgment and maintain professional skepticism throughout the audit. Identify and assess the risks of material noncompliance, whether due to fraud or error, and
design and perform audit procedures responsive to those risks. Such procedures include
examining, on a test basis, evidence regarding the City's compliance with the compliance
requirements referred to above and performing such other procedures as we considered
necessary in the circumstances. Obtain an understanding of the City's internal control over compliance relevant to the audit in
order to design audit procedures that are appropriate in the circumstances and to test and
report on internal control over compliance in accordance with the Uniform Guidance, but not
for the purpose of expressing an opinion on the effectiveness of the City's internal control
over compliance. Accordingly, no such opinion is expressed.
We are required to communicate with those charged with governance regarding, among other
matters, the planned scope and timing of the audit and any significant deficiencies and material
weaknesses in internal control over compliance that we identified during the audit.
Report on Internal Control over Compliance
A deficiency in internal control over compliance exists when the design or operation of a control over
compliance does not allow management or employees, in the normal course of performing their
assigned functions, to prevent, or detect and correct, noncompliance with a type of compliance
requirement of a federal program on a timely basis. A material weakness in internal control over
compliance is a deficiency, or combination of deficiencies, in internal control over compliance, such
that there is a reasonable possibility that material noncompliance with a type of compliance
requirement of a federal program will not be prevented, or detected and corrected, on a timely
basis. A significant deficiency in internal control over compliance is a deficiency, or a combination of
deficiencies, in internal control over compliance with a type of compliance requirement of a federal
program that is less severe than a material weakness in internal control over compliance, yet
important enough to merit attention by those charged with governance.
Our consideration of internal control over compliance was for the limited purpose described in
Auditor's Responsibilities for the Audit of Compliance section and was not designed to identify all
deficiencies in internal control over compliance that might be material weaknesses or significant
deficiencies in internal control over compliance. Given these limitations, during our audit we did not
identify any deficiencies in internal control over compliance that we consider to be material
weaknesses, as defined above. However, material weaknesses or significant deficiencies in internal
control over compliance may exist that were not identified.
7
Report on Internal Control over Compliance (Continued)
Our audit was not designed for the purpose of expressing an opinion on the effectiveness of internal
control over compliance. Accordingly, no such opinion is expressed.
The purpose of this report on internal control over compliance is solely to describe the scope of our
testing of internal control over compliance and the results of that testing based on the requirements
of the Uniform Guidance. Accordingly, this report is not suitable for any other purpose.
Report on Schedule of Expenditures of Federal Awards In Accordance with the Uniform Guidance
We have audited the financial statements of the governmental activities, the business-type
activities, each major fund, and the aggregate remaining fund information of the City of Eden
Prairie, Minnesota, as of and for the year ended December 31, 2023, and have issued our report
thereon dated April 22, 2024, which contained unmodified opinions on the financial statements. Our
audit was conducted for the purpose of forming an opinion on the financial statements as a whole.
The accompanying Schedule of Expenditures of Federal Awards is presented for purposes of
additional analysis as required by the Uniform Guidance and is not a required part of the financial
statements. Such information is the responsibility of management and was derived from and relates
directly to the underlying accounting and other records used to prepare the financial statements.
The information has been subjected to the auditing procedures applied in the audit of the financial
statements and certain additional procedures, including comparing and reconciling such information
directly to the underlying accounting and other records used to prepare the financial statements or
to the financial statements themselves, and other additional procedures in accordance with auditing
standards generally accepted in the United States of America. In our opinion, the Schedule of
Expenditure of Federal Awards is fairly stated, in all material respects, in relation to the basic
financial statements as a whole.
St. Cloud, Minnesota
April 22, 2024
8
City of Eden Prairie
Schedule of Findings and Questioned Costs
SECTION I – SUMMARY OF AUDITOR'S RESULTS
Financial Statements
Type of auditor's report issued: We issued an unmodified opinion on the
fair presentation of the financial
statements of the governmental activities,
business-type activities, each major fund,
and the aggregate remaining fund
information in accordance with accounting
principles generally accepted in the United
State of America (GAAP).
Internal control over financial reporting: Material weakness(es) identified? No Significant deficiency(ies) identified? None Reported
Noncompliance material to financial statements noted? No
Federal Awards
Type of auditor's report issued on compliance for major
programs: Unmodified
Internal control over major programs:
Material weakness(es) identified? No
Significant deficiency(ies) identified? None reported
Any audit findings disclosed that are required to
be reported in accordance with 2 CFR 200.516(a)? No
Identification of Major Programs
Assistance Listing No.: 14.218
Name of Federal Program or Cluster: Community Development Block Grant
Program
Dollar threshold used to distinguish
between type A and type B programs: $750,000
Auditee qualified as low-risk auditee? Yes
9
City of Eden Prairie
Schedule of Findings and Questioned Costs
SECTION II – FINANCIAL STATEMENT FINDINGS
None
SECTION III – FEDERAL AWARD FINDINGS AND QUESTIONED COSTS
None
SECTION IV – PRIOR YEAR FINDINGS AND QUESTIONED COSTS
None
10
Minnesota Legal Compliance
Independent Auditor's Report
Honorable Mayor and Members
of the City Council
City of Eden Prairie
Eden Prairie, Minnesota
We have audited, in accordance with auditing standards generally accepted in the United States of
America, and the standards applicable to financial audits contained in Government Auditing
Standards, issued by the Comptroller General of the United States, the financial statements of the
governmental activities, the business-type activities, each major fund, and the aggregate remaining
fund information of the City of Eden Prairie, Minnesota as of and for the year ended December 31,
2023, and the related notes to financial statements, which collectively comprise the City's basic
financial statements, and have issued our report thereon dated April 22, 2024.
In connection with our audit, nothing came to our attention that caused us to believe that the City
failed to comply with the provisions of the contracting – bid laws, depositories of public funds and
public investments, conflicts of interest, public indebtedness, claims and disbursements,
miscellaneous provisions, and tax increment financing sections of the Minnesota Legal Compliance
Audit Guide for Cities, promulgated by the State Auditor pursuant to Minnesota Statutes § 6.65,
insofar as they relate to accounting matters. However, our audit was not directed primarily toward
obtaining knowledge of such noncompliance. Accordingly, had we performed additional procedures,
other matters may have come to our attention regarding the City's noncompliance with the above
referenced provisions, insofar as they relate to accounting matters.
The purpose of this report is solely to describe the scope of our testing of compliance and the results
of that testing, and not to provide an opinion on compliance. Accordingly, this communication is not
suitable for any other purpose.
St. Cloud, Minnesota
April 22, 2024
City of Eden Prairie
Communications Letter
December 31, 2023
City of Eden Prairie
Table of Contents
Report on Matters Identified as a Result of
the Audit of the Basic Financial Statements 1
Required Communication 3
Financial Analysis 8
Emerging Issues 21
1
Report on Matters Identified as a Result of
the Audit of the Basic Financial Statements
Honorable Mayor, Members of the
City Council, and Management
City of Eden Prairie
Eden Prairie, Minnesota
In planning and performing our audit of the basic financial statements of the governmental activities,
business-type activities, each major fund, and the aggregate remaining fund information of the City
of Eden Prairie, Minnesota, as of and for the year ended December 31, 2023, in accordance with
auditing standards generally accepted in the United States of America and the standards applicable
to financial audits contained in Government Auditing Standards, issued by the Comptroller General
of the United States, we considered the City's internal control over financial reporting (internal
control) as a basis for designing audit procedures that are appropriate in the circumstances for the
purpose of expressing our opinions on the financial statements, but not for the purpose of expressing
an opinion on the effectiveness of the City's internal control. Accordingly, we do not express an
opinion on the effectiveness of the City's internal control over financial reporting.
Our consideration of internal control was for the limited purpose described in the preceding
paragraph and was not designed to identify all deficiencies in internal control that might be material
weaknesses or significant deficiencies and, therefore, material weaknesses or significant deficiencies
may exist that have not been identified. In addition, because of inherent limitations in internal
control, including the possibility of management override of controls, misstatements due to error, or
fraud may occur and not be detected by such controls.
A deficiency in internal control exists when the design or operation of a control does not allow
management or employees, in the normal course of performing their assigned functions, to prevent,
or detect and correct, misstatements on a timely basis. A material weakness is a deficiency, or a
combination of deficiencies, in internal control over financial reporting, such that there is a
reasonable possibility that a material misstatement of the City's basic financial statements will not
be prevented, or detected and corrected, on a timely basis. A reasonable possibility exists when the
likelihood of an event occurring is either reasonably possible or probable as defined as follows:
Reasonably possible. The chance of the future event or events occurring is more than remote
but less than likely.
Probable. The future event or events are likely to occur.
We did not identify any deficiencies in internal control that we consider to be material weaknesses.
A significant deficiency is a deficiency, or a combination of deficiencies, in internal control that is
less severe than a material weakness, yet important enough to merit attention by those charged with
governance.
2
The accompanying memorandum also includes financial analysis provided as a basis for discussion.
The matters discussed herein were considered by us during our audit and they do not modify the
opinion expressed in our Independent Auditor's Report dated April 22, 2024, on such statements.
The purpose of this communication, which is an integral part of our audit, is to describe for the City
Council and management and others within the City and state oversight agencies the scope of our
testing of internal control and the results of that testing. Accordingly, this communication is not
intended to be and should not be used for any other purpose.
St. Cloud, Minnesota
April 22, 2024
3
City of Eden Prairie
Required Communication
We have audited the basic financial statements of the governmental activities, business-type
activities, each major fund, and the aggregate remaining fund information of the City as of and for
the year ended December 31, 2023. Professional standards require that we advise you of the
following matters related to our audit.
Our Responsibility in Relation to the Financial Statement Audit
As communicated in our engagement letter, our responsibility, as described by professional
standards, is to form and express opinions about whether the basic financial statements prepared by
management with your oversight are presented fairly, in all material respects, in accordance with
accounting principles generally accepted in the United States of America. Our audit of the basic
financial statements does not relieve you or management of its respective responsibilities.
Our responsibility, as prescribed by professional standards, is to plan and perform our audit to obtain
reasonable, rather than absolute, assurance about whether the basic financial statements are free of
material misstatement. An audit of the basic financial statements includes consideration of internal
control over financial reporting as a basis for designing audit procedures that are appropriate in the
circumstances, but not for the purpose of expressing an opinion on the effectiveness of the City's
internal control over financial reporting. Accordingly, as part of our audit, we considered the
internal control of the City solely for the purpose of determining our audit procedures and not to
provide any assurance concerning such internal control.
We are also responsible for communicating significant matters related to the audit that are, in our
professional judgement, relevant to your responsibilities in overseeing the financial reporting
process. However, we are not required to design procedures for the purpose of identifying other
matters to communicate to you.
Generally accepted accounting principles provide for certain Required Supplementary Information
(RSI) to supplement the basic financial statements. Our responsibility with respect to the RSI, which
supplements the basic financial statements, is to apply certain limited procedures in accordance
with generally accepted auditing standards. However, the RSI was not audited and, because the
limited procedures do not provide us with sufficient evidence to express an opinion or provide any
assurance, we do not express an opinion or provide any assurance on the RSI.
Our responsibility for the supplementary information accompanying the basic financial statements,
as described by professional standards, is to evaluate the presentation of the supplementary
information in relation to the basic financial statements as a whole and to report on whether the
supplementary information is fairly stated, in all material respects, in relation to the basic financial
statements as a whole.
Our responsibility with respect to the other information in documents containing the audited basic
financial statements and auditor's report does not extend beyond the basic financial information
identified in the report. We have no responsibility for determining whether this other information is
properly stated. This other information was not audited, and we do not express an opinion or provide
any assurance on it.
4
City of Eden Prairie
Required Communication
Our Responsibility in Relation to Government Auditing Standards
As communicated in our engagement letter, part of obtaining reasonable assurance about whether
the basic financial statements are free of material misstatement, we performed tests of the City's
compliance with certain provisions of laws, regulations, contracts, and grant agreements,
noncompliance with which could have a direct and material effect on the determination of basic
financial statement amounts. However, the objective of our tests was not to provide an opinion on
compliance with such provisions.
Our Responsibility in Relation to Title 2 U.S. Code of Federal Regulations Part 200, Uniform
Administrative Requirements, Cost Principles, and Audit Requirements for Federal Awards
(Uniform Guidance)
As communicated in our engagement letter, in accordance with the Uniform Guidance, we examined
on a test basis, evidence about the City's compliance with the types of compliance requirements
described in the U.S. Office of Management and Budget (OMB) Compliance Supplement applicable to
each of its major federal programs for the purpose of expressing an opinion on the City's compliance
with those requirements. While our audit provided a reasonable basis for our opinion, it did not
provide a legal determination on the City's compliance with those requirements.
In planning and performing our audit of compliance, we considered the City's internal control over
compliance with the types of requirements that could have a direct and material effect on each
major federal program to determine the auditing procedures that are appropriate in the
circumstances for the purpose of expressing an opinion on compliance for each major federal
program and to test and report on internal control over compliance in accordance with the Uniform
Guidance, but not for the purpose of expressing an opinion on the effectiveness of internal control
over compliance.
Planned Scope and Timing of the Audit
We conducted our audit consistent with the planned scope and timing we previously communicated
to you.
Compliance with All Ethics Requirements Regarding Independence
The engagement team, others in our firm, as appropriate, our firm, and our network firms have
complied with all relevant ethical requirements regarding independence.
Significant Risks Identified
We have identified the following significant risks of material misstatements:
Improper Revenue Recognition
Revenue recognition is considered a fraud risk on substantially all engagements as it
generally has a significant impact on the results of the government operations. In
addition, complexities exist surrounding the calculation and recording of various revenue
sources.
Management Override of Controls through Journal Entries
Management override of internal control is considered a risk in substantially all
engagements as management may be incentivized to produce better results.
Lack of Segregation of Accounting Duties
If duties cannot be appropriately segregated within the accounting and finance
department, there is a risk of unauthorized disbursements being made from the City.
5
City of Eden Prairie
Required Communication
Significant Risks Identified (Continued)
Significant estimates – Depreciation, Net Pension Liability, Total Other Post Employment
Benefits (OPEB) Liability, Deferred Outflows of Resources Related to Pensions and OPEB, and
Deferred Inflows of Resources Related to Pensions and OPEB
Accounting estimates are an integral part of the basic financial statements prepared by
management and are based on management’s current judgements.
Qualitative Aspects of the City's Significant Accounting Practices
Significant Accounting Policies
Management has the responsibility to select and use appropriate accounting policies. A summary of
the significant accounting policies adopted by the City is included in the notes to the basic financial
statements. Policies applicable to GASB 96 and GASB 87 were adopted during 2023. No matters have
come to our attention that would require us, under professional standards, to inform you about (1)
the methods used to account for significant unusual transactions and (2) the effect of significant
accounting policies in controversial or emerging areas for which there is a lack of authoritative
guidance or consensus.
Significant Accounting Estimates
Accounting estimates are an integral part of the basic financial statements prepared by management
and are based on management's current judgements. Those judgements are normally based on
knowledge and experience about past and current events and assumptions about future events.
Certain accounting estimates are particularly sensitive because of their significance to the basic
financial statements and because of the possibility that future events affecting them may differ
markedly from management's current judgements. The most sensitive estimates affecting the basic
financial statements relate to:
Depreciation – The City is currently depreciating its capital assets over their estimated useful
lives, as determined by management, using the straight-line method.
Total Other Post Employment Benefits (OPEB) Liability, Deferred Outflows of Resources
Related to OPEB and Deferred Inflows of Resources Related to OPEB – These balances are
based on an actuarial study using the estimates of future obligations of the City for post
employment benefits.
Net Pension Liability, Deferred Outflows of Resources Related to Pensions and Deferred
Inflows of Resources Related to Pensions – These balances are based on an allocation by the
pension plans using estimates based on contributions.
We evaluated the key factors and assumptions used to develop the accounting estimates and
determined that they are reasonable in relation to the basic financial statements taken as a whole
and in relation to the applicable opinion units.
Financial Statement Disclosures
Certain basic financial statement disclosures involve significant judgment and are particularly
sensitive because of their significance to financial statement users. The basic financial statement
disclosures are neutral, consistent, and clear.
6
City of Eden Prairie
Required Communication
Significant Difficulties Encountered during the Audit
We encountered no significant difficulties in dealing with management relating to the performance
of the audit.
Uncorrected and Corrected Misstatements
For the purposes of this communication, professional standards require us to accumulate all known
and likely misstatements identified during the audit, other than those that we believe are trivial,
and communicate them to the appropriate level of management. Further, professional standards
require us to also communicate the effects of uncorrected misstatements related to prior periods on
the relevant classes of transactions, account balances or disclosures, and the basic financial
statements taken as a whole and each applicable opinion unit.
We identified the following uncorrected misstatement of the financial statements. Management has
determined its effect is immaterial, both individually and in the aggregate, to the basic financial
statements taken as a whole and each opinion unit. Uncorrected misstatements or matters
underlying those uncorrected misstatements could potentially cause future-period financial
statements to be materially misstated, even though the uncorrected misstatements are immaterial
to the financial statements currently under audit.
Extrapolated liquor inventory count variance
In addition, professional standards require us to communicate to you all material, corrected
misstatements that were brought to the attention of management as a result of our audit
procedures. None of the misstatements detected as a result of audit procedures and corrected by
management were material, either individually or in the aggregate, to the basic financial statements
taken as a whole.
Disagreements with Management
For purposes of this letter, professional standards define a disagreement with management as a
matter, whether or not resolved to our satisfaction, concerning a financial accounting, reporting, or
auditing matter, which could be significant to the City's basic financial statements or the auditor's
report. No such disagreements arose during the course of our audit.
Representations Requested from Management
We have requested certain written representations from management, which are included in the
management representation letter.
Management's Consultations with Other Accountants
In some cases, management may decide to consult with other accountants about auditing and
accounting matters. Management has informed us that, and to our knowledge, there were no
consultations with other accountants regarding auditing and accounting matters.
Other Significant Matters, Findings, or Issues
In the normal course of our professional association with the City, we generally discuss a variety of
matters, including the application of accounting principles and auditing standards, significant events
or transactions that occurred during the year, operating and regulatory conditions affecting the City,
and operational plans and strategies that may affect the risks of material misstatement. None of the
matters discussed resulted in a condition to our retention as the City's auditor.
7
City of Eden Prairie
Required Communication
Other Information Included in Annual Reports
Pursuant to professional standards, our responsibility as auditors for other information, whether
financial or nonfinancial, included in the City's annual reports, does not extend beyond the
information identified in the audit report and we are not required to perform any procedures to
corroborate such other information.
We applied certain limited procedures to the RSI that supplements the basic financial statements.
Our procedures consisted of inquiries of management regarding the methods of preparing the
information and comparing the information for consistency with management's responses to our
inquiries, the basic financial statements, and other knowledge we obtained during our audit of the
basic financial statements. We did not audit the RSI and do not express an opinion or provide any
assurance on the RSI.
With respect to the supplementary information accompanying the financial statements, we made
certain inquiries of management and evaluated the form, content and methods of preparing the
information to determine that the information complies with accounting principles generally
accepted in the United States of America, the method of preparing it has not changed from the prior
period, and the information is appropriate and complete in relation to our audit of the financial
statements. We compared and reconciled the supplementary information to the underlying
accounting records used to prepare the basic financial statements or to the basic financial
statements themselves.
We were not engaged to report on the other information accompanying the basic financial
statements but are not RSI. Such information has not been subjected to the auditing procedures
applied in the audit of the basic financial statements, and accordingly, we do not express an opinion
or provide any assurance on it.
Our responsibility also includes communicating to you any information which we believe is a material
misstatement of fact. Nothing came to our attention that caused us to believe that such information,
or its manner of presentation, is materially inconsistent with the information, or manner of its
presentation, appearing in the basic financial statements.
8
City of Eden Prairie
Financial Analysis
The following pages provide graphic representations of select data pertaining to the financial
position and operations of the City for the past five years. Our analysis of each graph is presented to
provide a basis for discussion of past performance and how implementing certain changes may
enhance future performance. We suggest you view each graph and document if our analysis is
consistent with yours. A subsequent discussion of this information should be useful for planning
purposes.
General Fund – Revenues
The following graph presents comparisons of revenues by type, illustrating the majority of revenue
for the City is from taxes and special assessments. This source represents 74.1% of total General
Fund revenues. Other revenues include items such as fines and forfeitures, investment earnings, and
other miscellaneous items.
Revenues of the General Fund increased from 2022 to 2023 by $265,141. Taxes and assessments
revenue increased by $1,698,725 due to an increase in levy. Intergovernmental revenue decreased
$3,523,314 due to previous year federal COVID grants received. Charges for Services increased
$616,726 due to registrations and memberships increasing since COVID started. Other Revenues
increased $1,722,127 due to an increase in investment income due to market conditions.
2019 2020 2021 2022 2023
Taxes and SpecialAssessments $35,029,637 $36,283,374 $37,836,186 $39,727,253 $41,425,978
Intergovernmental 1,768,464 6,238,109 5,353,219 5,345,840 1,822,526
Charges for Services 6,132,338 2,464,886 4,156,921 5,201,248 5,817,974
Licenses and Permits 5,110,672 4,996,872 5,858,459 5,303,467 5,054,344
Other 1,218,229 1,020,372 559,484 59,499 1,781,626
$-
$10,000,000
$20,000,000
$30,000,000
$40,000,000
$50,000,000
$60,000,000
General Fund Revenues
9
City of Eden Prairie
Financial Analysis
General Fund – Expenditures
The graph below represents the breakdown of expenditures by department. Police expenditures
continue to comprise the largest portion of General Fund expenditures, representing 33.43%. Overall,
General Fund expenditures increased $2,015,464 from 2022.
Police had an increase of $821,650 mainly due to an increase in wages and benefits. Parks and
Recreation increased $805,203 due mainly to an increase in wage and benefit expenditures as well.
Other department expenditures had relatively minor fluctuations when compared to the prior year.
2019 2020 2021 2022 2023
Debt Service $60,766 $60,765 $60,766 $20,662 $102,275
Parks and Recreation 12,489,302 11,084,484 12,343,285 13,635,118 14,440,321
Public Works 5,891,040 5,991,750 6,026,323 6,562,592 6,792,740
Fire 5,854,829 6,378,338 6,421,157 6,841,419 6,760,050
Police 15,204,092 15,357,194 16,145,234 17,032,495 17,854,145
Community Development 2,280,391 2,431,612 2,304,990 2,412,940 2,561,689
Administration 4,455,624 4,547,110 4,652,491 4,880,588 4,890,058
$-
$5,000,000
$10,000,000
$15,000,000
$20,000,000
$25,000,000
$30,000,000
$35,000,000
$40,000,000
$45,000,000
$50,000,000
$55,000,000
General Fund Expenditures
10
City of Eden Prairie
Financial Analysis
General Fund – Budgetary Comparison
Original
Actual
Amounts
Revenues
General Property Taxes and Assessments 41,142,158$ 41,142,158$ $41,425,978 283,820$
Licenses and permits 4,068,700 4,068,700 5,054,344 985,644
Intergovernmental revenue 1,401,300 1,401,300 1,822,526 421,226
Charges for services 5,571,287 5,571,287 5,817,974 246,687
Fines and forfeitures 367,000 367,000 349,641 (17,359)
Investments 150,000 150,000 1,190,635 1,040,635
Miscellaneous revenues 178,300 178,300 241,350 63,050
Total revenues 52,878,745 52,878,745 55,902,448 3,023,703
Expenditures
Administration 4,963,366 4,963,366 4,890,058 (73,308)
Community Development 2,681,120 2,681,120 2,561,689 (119,431)
Police 18,162,956 18,162,956 17,854,145 (308,811)
Fire 6,892,547 6,892,547 6,760,050 (132,497)
Public Works 7,001,848 7,023,098 6,792,740 (230,358)
Parks and Recreation 14,627,220 14,627,220 14,440,321 (186,899)
Debt Service 93,350 93,350 102,275 8,925
Total expenditures 54,422,407 54,443,657 53,401,278 (1,042,379)
Excess of revenues over
(under) disbursements (1,543,662) (1,564,912) 2,501,170 4,066,082
Other Financing Sources (Uses)
Transfers in 463,662 463,662 464,662 1,000
Transfers Out (20,000) (20,000) (2,681,850) (2,661,850)
Total other financing sources (uses)443,662 443,662 (2,217,188) (2,660,850)
Net change in fund balances (1,100,000)$ (1,121,250)$ 283,982$ 1,405,232$
Variance
With Final
Budget -
Over (Under)Final Budget
Overall, actual revenue was $3,023,703, or 5.7%, over budget. Licenses and permits were $985,644
over budget due to budgeting conservatively for permits, specifically building permits and
mechanical permits. Intergovernmental revenue was $421,226 above budget due to higher than
anticipated police and fire aids. Revenue from investments was $1,040,635 over budget due to
stronger than anticipated investment performance.
Overall, actual expenditures were less than budgeted amounts by $1,042,379, or 1.9%. Police was
$308,811 under budget due to open positions.
11
City of Eden Prairie
Financial Analysis
General Fund – Operations
The following graph shows the overall operations of the General Fund. Revenues have fluctuated
over the five years shown from a high in 2023 of $55,902,448 to a low of $49,259,340 in 2019.
Overall, from 2019 to 2023, revenues have increased $6,643,108. Similarly, expenditures have
fluctuated over the five years presented. In 2023, expenditures were $53,401,278, an increase from
the prior year of $2,015,464. Since 2019, expenditures have increased $7,165,234.
$49,259,340 $51,003,613 $53,764,269 $55,637,307 $55,902,448
$46,236,044 $45,851,253 $47,954,246 $51,385,814 $53,401,278
$27,888,522 $28,053,442 $30,550,473 $34,885,681 $35,561,962
$25,354,724 $26,197,429 $29,132,535 $33,252,089 $33,607,091
$0
$5,000,000
$10,000,000
$15,000,000
$20,000,000
$25,000,000
$30,000,000
$35,000,000
$40,000,000
$45,000,000
$50,000,000
$55,000,000
$60,000,000
2019 2020 2021 2022 2023
General Fund Operations
Total Revenues Total Expenditures Cash and Investment Balance Unassigned Fund Balance
As illustrated above, the General Fund Unassigned Fund Balance, increased $355,002 from
$33,252,089 at December 31, 2022, to $33,607,091 at December 31, 2023. Over the last five years,
the City has been able to maintain steady cash and fund balances in a period of generally increasing
costs and variable revenues.
The City's fund balance policy indicates they will strive to maintain a minimum working capital fund
balance not less than 50% of next year's budgeted tax revenue, an emergency fund balance for
contingencies of 10% of next year's budget and a budget balancing measure of 5% to 7% of next year's
budget in unassigned fund balance. As of December 31, 2023, the City's unassigned fund balance of
$33,607,091 was in compliance with the City's fund balance policy.
12
City of Eden Prairie
Financial Analysis
Water Operations
The following graph illustrates the current operations of the Water Fund for the past five years.
Operating income is shown with and without depreciation below.
Operating revenue increased $822,209, or 7.5%, from 2022 based on changes in rates, and increased
consumption due to the dry year. Operating expenses decreased by $242,829 or 1.8%. The decrease
is mainly due to a decrease in the meter change out program. The net effect of the increased
revenues and expenses is an operating loss of $1,205,678. This was a decrease of $1,065,038 in the
operating loss reported in 2022.
Enterprise funds may be used to account for any activity in which a fee is charged. It is not required
to have the fee support the entire activity; however, the basic premise in establishing an enterprise
fund is that the activity will be operated similar to a business. Therefore, it is expected the
enterprise fund would at least be able to meet its obligations currently and into the future.
2019 2020 2021 2022 2023
Operating Revenues $7,699,582 $8,987,364 $10,682,945 $11,008,837 $11,831,046
Operating Expenses 9,570,276 9,342,242 12,178,395 13,279,553 13,036,724
Operating Loss with Depreciation (1,870,694) (354,878) (1,495,450) (2,270,716) (1,205,678)
Depreciation 2,880,971 2,900,056 2,957,215 2,948,104 3,065,370
Operating Income withoutDepreciation 1,010,277 2,545,178 1,461,765 677,388 1,859,692
$(3,000,000)
$-
$3,000,000
$6,000,000
$9,000,000
$12,000,000
$15,000,000
Water Operations
13
City of Eden Prairie
Financial Analysis
Water Fund
2019 2020 2021 2022 2023
Cash and Investments $17,264,600 $14,469,884 $21,181,148 $21,853,794 $20,467,342
Unrestricted Net Position 13,630,544 7,019,905 8,961,105 14,332,945 19,374,894
$-
$5,000,000
$10,000,000
$15,000,000
$20,000,000
$25,000,000
Water Fund
The above graph shows the cash and investment and unrestricted net position balances as of
December 31, for the last five years. The Water Fund cash and investment balance has increased
$3,202,742 since 2019. The cash and investment balance decreased $1,386,452 during 2023 while the
unrestricted net position for the Water Fund increased $5,041,949 during the same time period.
14
City of Eden Prairie
Financial Analysis
Wastewater Operations
The following graph illustrates the current operations of the Wastewater Fund for the past five years.
Operating income is shown with and without depreciation below.
The Wastewater Fund has shown an operating income for the first time in the five years presented.
In 2023, the Fund showed an operating income of $54,886. This is an increase of $896,091 in the
operating income from 2022. The Fund experienced an increase in operating revenue of $207,868
based on rates, while wastewater expenses decreased $688,223. The decrease in expenses is mainly
due to fewer expenses for the lift station rehab program.
2019 2020 2021 2022 2023
Operating Revenues $6,726,548 $6,895,764 $7,460,750 $7,517,471 $7,725,339
Operating Expenses 7,658,620 7,501,203 7,479,832 8,358,676 7,670,453
Operating Income (Loss) withDepreciation (932,072) (605,439) (19,082) (841,205) 54,886
Depreciation 1,710,224 1,677,800 1,677,036 1,663,532 1,377,115
Operating Income without
Depreciation 778,152 1,072,361 1,657,954 822,327 1,432,001
$(2,000,000)
$-
$2,000,000
$4,000,000
$6,000,000
$8,000,000
$10,000,000
Wastewater Operations
15
City of Eden Prairie
Financial Analysis
Wastewater Fund
2019 2020 2021 2022 2023
Cash and Investments $5,626,666 $7,048,754 $8,761,588 $9,476,152 $11,417,839
Unrestricted Net Position 7,191,183 8,403,748 10,347,930 11,137,661 13,164,168
$-
$2,000,000
$4,000,000
$6,000,000
$8,000,000
$10,000,000
$12,000,000
$14,000,000
Wastewater Fund
The graph above shows the cash and investment and unrestricted net position balances as of
December 31, for the last five years. The Wastewater Fund cash and investment balance has
increased $5,791,173 since 2019. In 2023, the Wastewater Fund cash and investment balance
increased $1,941,687 while the unrestricted net position increased $2,026,507.
16
City of Eden Prairie
Financial Analysis
Stormwater Operations
The following graph illustrates the current operations of the Stormwater Fund for the past five years.
Operating revenue increased $109,025 due to increased rates while expenses increased $78,313
compared to 2022. Expenses increased due to an increase in repair and maintenance costs. The net
effect of the changes in revenues and expenses was operating income of $649,983.
2019 2020 2021 2022 2023
Operating Revenues $3,125,251 $3,376,785 $3,631,369 $3,770,562 $3,879,587
Operating Expenses 2,402,226 2,518,293 2,876,223 3,151,291 3,229,604
Operating Income (Loss) with Depreciation 723,025 858,492 755,146 619,271 649,983
Depreciation 1,120,096 1,162,430 1,187,156 1,148,498 1,042,310
Operating Income without Depreciation 1,843,121 2,020,922 1,942,302 1,767,769 1,692,293
$-
$500,000
$1,000,000
$1,500,000
$2,000,000
$2,500,000
$3,000,000
$3,500,000
$4,000,000
Stormwater Operations
17
City of Eden Prairie
Financial Analysis
Stormwater Fund
2019 2020 2021 2022 2023
Cash and Investments $3,595,474 $5,396,835 $6,488,795 $5,335,984 $6,533,094
Unrestricted Net Position 3,240,336 5,272,296 6,858,202 5,767,989 6,925,348
$-
$1,000,000
$2,000,000
$3,000,000
$4,000,000
$5,000,000
$6,000,000
$7,000,000
$8,000,000
Stormwater Fund
As of December 31, 2023, the Stormwater Fund had an ending net cash and investment balance of
$6,533,094. This is an increase of $1,197,110 compared to 2022. Unrestricted net position at year-
end was $6,925,348 and also increased $1,157,359 compared to the prior year.
18
City of Eden Prairie
Financial Analysis
Liquor Operations
The City's liquor store reported consistent sales from 2022 to 2023. Cost of sales increased by 0.2%.
Operating expenses in the Liquor Fund stayed relatively consistent with prior year, increasing by
$195,057. The City's gross profit percentage remained consistent from 2022 to 2023. The City's gross
profit percentage is higher than 2 of the 3 metro stores presented below and above the metro
municipal average.
2019 2020 2021 2022 2023
Sales and Operating Revenue $10,977,643 $11,711,560 $11,923,359 $12,067,226 $12,069,015
Cost of Sales 7,843,984 8,299,999 8,371,936 8,450,887 8,470,531
Gross Profit 3,133,659 3,411,561 3,551,423 3,616,339 3,598,484
Operating Expenses 2,379,148 2,297,060 2,545,548 2,591,577 2,786,634
Operating Income 754,511 1,114,501 1,005,875 1,024,762 811,850
Depreciation 107,496 73,389 38,021 232,829 232,829
Operating Income without Depreciation 862,007 1,187,890 1,043,896 1,257,591 1,044,679
$-
$2,000,000
$4,000,000
$6,000,000
$8,000,000
$10,000,000
$12,000,000
$14,000,000
Liquor Operations
2023
Metro
City of City of City of City of City of Municipal
Eden Prairie** Eden Prairie** Edina* Richfield* Savage* Average*
Sales and operating revenue 12,069,015$ 12,067,226$ 14,427,474$ 14,200,736$ 6,948,251$ 8,420,363$
Costs of sales 8,470,531 8,450,887 10,010,262 10,659,157 5,012,280 6,113,690
Gross profit 3,598,484 3,616,339 4,417,212 3,541,579 1,935,971 2,306,673
Operating expenses 2,786,634 2,591,577 3,723,521 2,565,546 1,467,439 1,825,288
Operating income 811,850 1,024,762 693,691 976,033 468,532 481,385
Gross profit percentage 29.8%30.0%30.6%24.9%27.9%27.4%
2022
* Individual metro municipal and averages obtained from the Office of State Auditor, Analysis of
Municipal Liquor Store Operations Report.
** Includes building lease activity which can affect comparability of information presented above.
19
City of Eden Prairie
Financial Analysis
Liquor Fund
2019 2020 2021 2022 2023
Cash and Investments $1,869,891 $2,330,123 $2,626,281 $2,618,889 $2,740,202
Unrestricted Net Position 1,461,891 1,863,641 2,102,879 2,315,074 2,481,837
$-
$500,000
$1,000,000
$1,500,000
$2,000,000
$2,500,000
$3,000,000
Liquor Fund
The graph above shows the cash and investment and unrestricted net position balances as of
December 31 for the last five years. The Liquor Fund cash and investment balance has increased
$870,311 since 2019. In 2023, the Liquor Fund cash and investment balance increased $121,313 while
the unrestricted net position increased $166,763.
Information above includes building lease activity which should be considered when evaluating fund
performance.
20
City of Eden Prairie
Financial Analysis
Tax Levy, Capacity, And Rates
The graph below presents information relating to the City's tax levy, tax capacity and rates.
The levy for 2023 includes the General Fund levy of $41,956,284 plus a levy for the Debt Service of
$2,553,000 and Capital Project Funds totaling $400,000.
As illustrated below, the taxable tax capacity of the City has experienced a steady increase over the
last five years. While the City has increased the levy during this period, the tax capacity rate has
declined because of increases in market values and tax capacity.
$112,559,846 $116,554,959 $120,595,985
$122,841,504
$143,680,523
$38,278,724 $39,621,102 $41,014,490 $43,102,554 $44,909,284
31.52 31.51 31.43 32.32 28.90
-
25.00
50.00
75.00
100.00
$-
$20,000,000
$40,000,000
$60,000,000
$80,000,000
$100,000,000
$120,000,000
$140,000,000
$160,000,000
2019 2020 2021 2022 2023
Tax Capacity, Levy, and Rates
Tax Capacity Certified Tax Levy Tax Capacity Rate
City of Eden Prairie
Emerging Issues
21
Executive Summary
The following is an executive summary of financial related updates to assist you in staying current on
emerging issues in accounting and finance. This summary will give you a preview of the new
standards that have been recently issued and what is on the horizon for the near future. The most
recent and significant updates include:
Implementation Guide No. 2021-1 – Amending Capitalization Requirements
GASB has issued Implementation Guide No. 2021-1, amending previously issued guidance
regarding capitalization requirements for capital assets that are significant in the aggregate
but below the government's capitalization threshold individually. Accounting Standard Update – GASB Statement No. 100 – Accounting Changes and Error
Corrections
GASB has issued GASB Statement No. 100 relating to accounting and financial reporting for
accounting changes and error corrections. The requirements of this Statement will improve
the clarity of the accounting and financial reporting requirements for accounting changes and
error corrections, which will result in greater consistency in application in practice. In turn,
more understandable, reliable, relevant, consistent, and comparable information will be
provided to financial statement users for making decisions or assessing accountability. Accounting Standard Update – GASB Statement No. 101 – Compensated Absences
GASB has issued GASB Statement No. 101 relating to accounting and financial reporting for
compensated absences. The unified recognition and measurement model in this Statement
will result in a liability for compensated absences that more appropriately reflects when a
government incurs an obligation. In addition, the model can be applied consistently to any
type of compensated absence and will eliminate potential comparability issues between
governments that offer different types of leave.
The following are extensive summaries of the current updates. As your continued business partner,
we are committed to keeping you informed of new and emerging issues. We are happy to discuss
these issues with you further and their applicability to your City.
Implementation Guide No. 2021-1 – Amending Capitalization Requirements
Implementation Guide No. 2021-1, amended previously issued guidance contained in Implementation
Guide No. 2015-1 regarding capitalization requirements for capital assets that are significant in the
aggregate.
Original guidance stated that it may be appropriate for a government to establish a capitalization
policy that would require capitalization for certain types of assets with individual acquisition costs
that are less than the threshold for an individual asset.
Amended guidance states that a government should capitalize assets whose individual acquisition
costs are less than the threshold for an individual asset if those assets in the aggregate are
significant. Computers and classroom furniture are common examples of asset types that could be
significant collectively. The amended guidance clarifies that if 100 computers costing $1,500 each
totaling a $150,000 aggregate amount is significant, the government should capitalize the
computers.
Information provided above was obtained from www.gasb.org.
City of Eden Prairie
Emerging Issues
22
Accounting Standard Update – GASB Statement No. 100 – Accounting Changes and Error
Corrections – an Amendment of GASB Statement No. 62
The primary objective of this Statement is to enhance accounting and financial reporting
requirements for accounting changes and error corrections to provide more understandable, reliable,
relevant, consistent, and comparable information for making decisions or assessing accountability.
This Statement defines accounting changes as changes in accounting principles, changes in
accounting estimates, and changes to or within the financial reporting entity and describes the
transactions or other events that constitute those changes. As part of those descriptions, for (1)
certain changes in accounting principles and (2) certain changes in accounting estimates that result
from a change in measurement methodology, a new principle or methodology should be justified on
the basis that it is preferable to the principle or methodology used before the change. That
preferability should be based on the qualitative characteristics of financial reporting –
understandability, reliability, relevance, timeliness, consistency, and comparability. This Statement
also addresses corrections of errors in previously issued financial statements.
This Statement prescribes the accounting and financial reporting for (1) each type of accounting
change and (2) error corrections. This Statement requires that (a) changes in accounting principles
and error corrections be reported retroactively by restating prior periods, (b) changes to or within
the financial reporting entity be reported by adjusting beginning balances of the current period, and
(c) changes in accounting estimates be reported prospectively by recognizing the change in the
current period. The requirements of this Statement for changes in accounting principles apply to the
implementation of a new pronouncement in absence of specific transition provisions in the new
pronouncement.
This Statement also requires that the aggregate amount of adjustments to and restatements of
beginning net position, fund balance, or fund net position, as applicable, be displayed by reporting
unit in the financial statements.
This Statement requires disclosure in notes to financial statements of descriptive information about
accounting changes and error corrections, such as their nature. In addition, information about the
quantitative effects on beginning balances of each accounting change and error correction should be
disclosed by reporting unit in a tabular format to reconcile beginning balances as previously reported
to beginning balances as restated.
Furthermore, this Statement addresses how information that is affected by a change in accounting
principle or error correction should be presented in Required Supplementary Information (RSI) and
Supplementary Information (SI). For periods that are earlier than those included in the basic financial
statements, information presented in RSI or SI should be restated for error corrections, if
practicable, but not for changes in accounting principles.
GASB Statement No. 100 is effective for reporting periods beginning after June 15, 2023. Earlier
application is encouraged.
Information provided above was obtained from www.gasb.org.
City of Eden Prairie
Emerging Issues
23
Accounting Standard Update – GASB Statement No. 101 – Compensated Absences
The objective of this Statement is to better meet the information needs of financial statement users
by updating the recognition and measurement guidance for compensated absences. That objective is
achieved by aligning the recognition and measurement guidance under a unified model and by
amending certain previously required disclosures.
This Statement requires that liabilities for compensated absences be recognized for (1) leave that
has not been used and (2) leave that has been used but not yet paid in cash or settled through
noncash means. A liability should be recognized for leave that has not been used if (a) the leave is
attributable to services already rendered, (b) the leave accumulates, and (c) the leave is more likely
than not to be used for time off or otherwise paid in cash or settled through noncash means. Leave is
attributable to services already rendered when an employee has performed the services required to
earn the leave. Leave that accumulates is carried forward from the reporting period in which it is
earned to a future reporting period during which it may be used for time off or otherwise paid or
settled. In estimating the leave that is more likely than not to be used or otherwise paid or settled, a
government should consider relevant factors such as employment policies related to compensated
absences and historical information about the use or payment of compensated absences. However,
leave that is more likely than not to be settled through conversion to defined benefit
postemployment benefits should not be included in a liability for compensated absences.
This Statement requires that a liability for certain types of compensated absences – including
parental leave, military leave, and jury duty leave – not be recognized until the leave commences.
This Statement also requires that a liability for specific types of compensated absences not be
recognized until the leave is used.
This Statement also establishes guidance for measuring a liability for leave that has not been used,
generally using an employee's pay rate as of the date of the financial statements. A liability for leave
that has been used but not yet paid or settled should be measured at the amount of the cash
payment or noncash settlement to be made. Certain salary-related payments that are directly and
incrementally associated with payments for leave also should be included in the measurement of the
liabilities.
With respect to financial statements prepared using the current financial resources measurement
focus, this Statement requires that expenditures be recognized for the amount that normally would
be liquidated with expendable available financial resources.
This Statement amends the existing requirement to disclose the gross increases and decreases in a
liability for compensated absences to allow governments to disclose only the net change in the
liability (as long as they identify it as a net change). In addition, governments are no longer required
to disclose which governmental funds typically have been used to liquidate the liability for
compensated absences.
GASB Statement No. 101 is effective for reporting periods beginning after December 15, 2023. Earlier
application is encouraged.
Information provided above was obtained from www.gasb.org.
PROCLAMATION
City of Eden Prairie
Hennepin County, Minnesota
WHEREAS, the increasing number of seniors in Eden Prairie bring many
opportunities and challenges for all components of our City – families, businesses,
and government; and
WHEREAS, every segment of our society is influenced by the needs, resources and
expertise of our senior; and awareness improves participation and action; and
WHEREAS, our Eden Prairie seniors play a pivotal role in formal and informal
education, sharing years of accumulated experience and wisdom which will impact
our future; and
WHEREAS, the community wishes to celebrate and acknowledge the contributions
and accomplishments of the seniors in our community and recognize the
organizations that serve older adults; and
WHEREAS, Senior Awareness Month recognizes that seniors are an integral part of
our community.
NOW, THEREFORE, the Eden Prairie City Council does hereby proclaim May 2024
as:
SENIOR AWARENESS MONTH
ADOPTED by the Eden Prairie City Council on this 7th day of May 2024.
Ronald A. Case, Mayor
on behalf of Council Members:
Kathy Nelson
Mark Freiberg
PG Narayanan
Lisa Toomey
ITEM IV.C.
UNAPPROVED WORKSHOP MINUTES CITY COUNCIL WORKSHOP & OPEN PODIUM
TUESDAY, APRIL 16, 2024 CITY CENTER
5:00 – 6:25 PM, HERITAGE ROOMS 6:30 – 7:00 PM, COUNCIL CHAMBER CITY COUNCIL: Mayor Ron Case, Council Members Kathy Nelson, Mark Freiberg, PG Narayanan, and Lisa Toomey
CITY STAFF: City Manager Rick Getschow, Police Chief Matt Sackett, Fire Chief Scott Gerber, Public Works Director Robert Ellis, Community Development Director Julie Klima, Parks and Recreation Director Amy Markle, Administrative Services/HR Director Alecia Rose, Communications Manager Joyce Lorenz, City Attorney Maggie Neuville, and Recorder Sara
Aschenbeck
Workshop - Heritage Rooms I and II (5:30) I. MARSHALL FARM PROPERTY (9905 DELL ROAD)
Getschow stated Lake West Development will give an update of work completed since the
February workshop presentation. Klima explained the developer held a neighborhood meeting
last week. A traffic study was also completed. Ellis explained the City’s Engineering team
manages traffic studies. The current proposal is expected to generate 860 trips in and out of the
development daily. 67 vehicles are expected to enter or leave the development in the morning
peak hour, and 79 vehicles are expected to enter or leave in the evening peak hour. For
comparison, if the development were solely single family homes there would be 18 fewer trips in
both the morning and evening peak hours. These findings have an almost immaterial traffic
impact on the existing roadways and lead to no traffic or safety concerns.
Kelsey Thompson, Lake West Development Director of Development, explained in addition to a
neighborhood meeting and a traffic study, line of sight drawings, floor plans, and preliminary
engineering drawings were also completed. 265 households in a 500 foot buffer around the
property received a mailed notice for the neighborhood meeting. At least 26 households attended
and there was meaningful discussion.
Case asked if the traffic study considered this development will be geared towards empty nesters,
who generate fewer traffic trips than a family with children. Ellis stated the traffic study is not
that granular but was completed utilizing guidance from the Institute of Transportation Engineers
Trip Generation Manual. Curt Fretham, Lake West Development CEO, noted the largest
neighborhood concern was traffic, however the number of trips generated per the traffic study
may be overstated due to the targeted demographic. Ellis noted the City must be conservative
with number of trips generated as anyone can move into this development. Case stated the City
City Council Workshop Minutes April 16, 2024
Page 2
should research previous developments marketed toward empty nesters to confirm how many
units were purchased by the intended demographic.
Case stated drivers will often change their route due to steep slopes, road width, and poor
sightlines. He asked if the traffic study considers human nature. Ellis stated the traffic study
attempts to estimate peoples origins and destinations, however it cannot account for human
nature. Case asked if the City has traffic counts for Dell Road. Ellis confirmed the City does
have traffic counts for Dell Road. Nelson asked if the trips generated include Amazon deliveries.
Ellis confirmed the trips generated are inclusive of Amazon deliveries. Case reiterated traffic
generated by the proposed development would be similar to a development of solely single
family homes. Narayanan added more individuals are working from home post COVID.
Thompson stated one neighbor was concerned with how close the townhomes were to their
property. Another neighbor shared density concerns. Neighbors had concerns over the location of
the pickleball court. Getschow noted City staff will likely have recommendations on location of
the pickleball court. Freiberg asked if any neighbors voiced the parcel should not be developed.
Fretham stated neighbors did not communicate the parcel should not be developed. Toomey
asked if Lake West Development has developed a similar project with both single family homes
and attached townhome flats. Fretham answered this development is the first of its kind.
Thompson summarized qualities of the project neighbors were in favor of. Neighbors were
supportive of the preserved green space abutting their properties, and new amenities such as
walking trails. Case asked if there was any negative sentiment regarding the three story
townhome flat buildings. Fretham stated one neighbor was initially opposed, but other neighbors
appreciated the attached housing leaving room for open space and green initiatives. Case asked if
neighbors were favorable at a high level. Fretham stated neighbors were generally in favor of the
project at a high level.
Case asked Klima to share her reflections of the neighborhood meeting. Klima noted the
development team facilitated a two-way conversation. The neighborhood asked many questions
including if amenities were only available for development residents, if trees are to be preserved,
and if there is enough visitor parking. Residents had questions on the timeline and process, and
when the Dell Road street project would occur. A resident shared that the attached townhome
flats looked too much like an apartment building. There was confusion regarding what a villa
home is, and if the properties were purchased or rented. Fretham added residents approved once
they understood the villa homes were to be purchased. Klima stated at the end of the meeting
residents expressed the development was on the right track by preserving open space and
creating housing needed by an aging population. All attendees were concerned about traffic.
Narayanan asked if the City sends a follow up letter to attendees answering frequently asked
questions. Klima stated there were handouts available for attendees at the neighborhood meeting.
If the project moves forward to an application, those documents will be available of the City’s
City Council Workshop Minutes April 16, 2024
Page 3
online development projects map. Thompson added she emailed a copy of the project narrative
to all neighbors who signed in at the neighborhood meeting.
Nelson asked where guest parking is located. Thompson stated each building is required by code
to have 180 parking stalls. 200 underground parking stalls are planned, leaving 20 extra parking
stalls per building. There is additional visitor parking above ground. Nelson stated more guest
parking is needed for days such as Thanksgiving. Case asked how many outside parking stalls
are planned. Thompson answered there will be approximately 60 outside parking stalls for
guests. Toomey asked if the single family homes will have a two-car garage. Fretham answered
all single family homes will have either a two- or three-car garage. Case asked if the road will be
wide enough for two parking lanes. Ellis stated the City expects the road will be wide enough for
two parking lanes.
Thompson presented line of sight drawings for the Council. Fretham noted the development is
far from existing neighbors. Nelson asked how many levels the townhome flats are. Thompson
stated the townhome flat buildings are three levels, individual units are one level. Nelson asked
the developer to elaborate on the elevators. Thompson noted one elevator will service six units,
two units on each story. The entrances are on grade without steps and are ADA accessible.
Thompson presented preliminary engineering drawings and noted the planned stormwater pond
is larger than expected need. Case asked if there are any berming walls needed. Fretham
confirmed the proposal is on grade and does not need a berming wall. Narayanan asked if the
developer would install a privacy fence or plant trees strategically to alleviate concerns of the
neighbor closest to the development. Fretham stated the development team is meeting with the
neighbor next week to discuss possibilities.
Thompson explained the developer is planning discussions with the University of Minnesota
Landscape Arboretum and other University of Minnesota entities over ownership of the
community garden and open green space. Case asked if the tree line to the North is on Marshall
Farm property. Fretham confirmed that tree line is on Marshall Farm property. Case asked if the
developer is planning to keep the tree line. Fretham confirmed the developer is planning to keep
the tree line. Thompson added there is an elevation change from existing neighbors to the north
and the development property, which helps with sight line disruption.
Fretham stated the development team is exploring installing solar panels on the roof. Narayanan
asked if the solar panels cost would be added to the cost of each townhome flat unit. Fretham
confirmed the cost of the solar panels would be included as a one time Homeowner Association
cost. Nelson stated she is agreeable to adding solar, it would likely cover common area energy
needs.
Case asked the Council if they generally approve or disapprove of the project at a high level.
Getschow added a comprehensive plan amendment would be needed for this project, which
requires a supermajority vote to approve. Narayanan asked if the City is alright with the amount
of traffic trips generated. Ellis confirmed there are no traffic issues under any scenario. The
City Council Workshop Minutes April 16, 2024
Page 4
difference between traffic trips generated for the proposed project and 55 single family houses is
virtually unnoticeable. Narayanan stated the underground parking and semi-private elevators are
a nice amenity for seniors, and the project does have its positives. The pickleball location is still
an area of concern. Narayanan asked if it is possible for the developer to propose developing the
green space in the future. Getschow stated the green space would likely be designated as a
conservation area. Klima added the open space would be protected and is not to be developed.
Toomey stated she is okay with the project, but asked if the outside of the villa homes can be
customized and stated she dislikes when every home in a development looks identical. Freiberg
stated the developer did their due diligence and noted he is alright with the project. Case stated
he is alright with the project moving forward as proposed. Nelson stated the townhome flats are a
new type of housing. Nelson asked if the developer must supply affordable units and noted the
price per unit is high. Klima stated the City’s inclusionary housing policy applies to the 90 units
of attached townhome flat housing but does not apply to the single family homes. The developer
can choose to pay a fee in lieu of supplying affordable units. The Council thanked Lake West
Development for their time.
Open Podium - Council Chamber (6:30) II. OPEN PODIUM
a. ALICE WILLIAMS AND EVIE WILSFORD, EDEN BROOK
CONSERVATION AREA TRASH RECEPTACLES
Williams and Wilsford stated they would like to prevent litter in the Eden Brook Conservation
Area. They proposed adding an informational sign, trash cans, and bags for pet waste. Case
encouraged Williams and Wilsford to pursue this project, and connected them with Amy Markle,
Parks and Recreation Director, to ideate further.
III. ADJOURNMENT
UNAPPROVED MINUTES EDEN PRAIRIE CITY COUNCIL MEETING TUESDAY, APRIL 16, 2024 7:00 PM, CITY CENTER CITY COUNCIL Mayor Ron Case, Council Members Mark Freiberg, PG Narayanan, Kathy Nelson, and Lisa Toomey CITY STAFF City Manager Rick Getschow, Public Works Director Robert Ellis, Parks and Recreation Director Amy Markle, Community Development Director Julie Klima, Police Chief Matt Sackett, Fire Chief Scott Gerber, and City Attorney Maggie Neuville I. CALL THE MEETING TO ORDER
Mayor Case called the meeting to order at 7:00 PM. All Council Members were present. II. PLEDGE OF ALLEGIANCE
III. OPEN PODIUM INVITATION IV. PROCLAMATIONS / PRESENTATIONS A. SMALL BUSINESS WEEK PROCLAMATION
Getschow explained the proclamation is in support of Eden Prairie’s business economy joining in a national effort to recognize the contributions of small
business to the local and national economy.
Case read the proclamation.
B. ARBOR DAY PROCLAMATION
Getschow explained the City’s Arbor Day Walk and Green Fair is Saturday, April 27 from 10:00 a.m. to 1:00 p.m. at Round Lake Park.
Markle added the trees purchased by residents will be available for pickup. At the
event, residents are encouraged to celebrate Arbor Day with a walk at Round Lake
Park, enjoy free seedlings and compost, and participate in a garden tool swap.
Case read the proclamation.
V. APPROVAL OF AGENDA AND OTHER ITEMS OF BUSINESS
MOTION: Toomey moved, seconded by Narayanan, to approve the agenda as published.
CITY COUNCIL MINUTES April 16, 2024
Page 2
Motion carried 5-0. VI. MINUTES
A. COUNCIL WORKSHOP HELD TUESDAY, APRIL 2, 2024
B. CITY COUNCIL MEETING HELD TUESDAY, APRIL 2, 2024
MOTION: Narayanan moved, seconded by Nelson, to approve the minutes of the
Council workshop held Tuesday, April 2, 2024, and the City Council meeting held Tuesday, April 2, 2024, as published. Motion carried 5-0. VII. REPORTS OF ADVISORY BOARDS AND COMMISSIONS
VIII. CONSENT CALENDAR A. CLERK’S LIST
B. ADOPT RESOLUTION NO. 2024-039 TERMINATING DEFERRED SPECIAL ASSESSMENT, APPROVE SPECIAL ASSESSMENT AGREEMENT WITH RILEY PURGATORY BLUFF CREEK WATERSHED DISTRICT
C. APPROVE PROFESSIONAL SERVICES AGREEMENT FOR RAINBOW DRIVE CULVERT REPLACEMENT CONSTRUCTION ADMINISTRATION WITH SRF CONSULTING GROUP
D. AWARD CONTRACT FOR 2024 PAVEMENT REHABILITATION PROJECT TO BITUMINOUS ROADWAYS, INC.
E. AUTHORIZE POLICE INSPECTOR VEHICLE REPLACEMENT
F. APPROVE PROFESSIONAL SERVICES AGREEMENT FOR SANITARY SEWER MODELING SERVICES WITH ADVANCED ENGINEERING AND ENVIRONMENTAL SERVICES
G. AWARD CONTRACT FOR 2024 MUDJACKING TO METRO CONCRETE RAISING INC.
H. AWARD CONTRACT FOR 2024 CRACK SEAL PROJECT TO NORTHWEST ASPHALT AND MAINTENANCE
I. AWARD CONTRACT FOR 2024 PAVEMENT MARKING TO SIR LINES-A-LOT LLC
J. APPROVE CONTRACT WITH GRANICUS, LLC FOR WEBSITE HOSTING, EMAIL/TEXT SUBSCRIPTION, AND STREAMING VIDEO
CITY COUNCIL MINUTES April 16, 2024
Page 3
SERVICES
MOTION: Nelson moved, seconded by Freiberg, to approve Items A-J on the Consent Calendar. Motion carried 5-0.
IX. PUBLIC HEARINGS / MEETINGS A. EDEN PRAIRIE PUBLIC SCHOOLS/UNFI by Eden Prairie Public Schools. Resolution No. 2024-040 for a Guide Plan Change from Office and Parks & Open Space to Public/Semi-Public and Parks & Open Space on 60.91 acres, first reading of Ordinance for Zoning District Change and Planned Unit Development District Review with waivers on 60.91 acres.
Getschow explained the property at 11840 Valley View Road is currently owned by UNFI. Eden Prairie School District has contracted to purchase the property at 11840 Valley View Road and is requesting that the property be reguided and rezoned to allow the property to be used for school purposes. There won’t be any changes to the site itself. He added the Planning Commission voted unanimously
to recommend approval of the project. Klima pointed out the proposed action is to change the Guide Plan and any additional changes to the property would need to be reviewed by the Council.
Freiberg asked why the change is being requested while the purchase is still pending. Klima explained it is fairly common for purchases to be contingent upon City allowances. Getschow noted a presentation was provided by the applicant to the Planning
Commission. The main uses will be the Tassel Program and restarting their alternative learning center. There were no comments from the audience. MOTION: Toomey moved, seconded by Narayanan, to close the public hearing, and to adopt Resolution No. 2024-040 a Guide Plan Change from Office and Parks and Open Space to Public/Semi-Public and Parks and Open Space on 60.91 acres, approve the first reading of the Ordinance for a Zoning District Change from Office and Rural to Public and Parks and Open Space and Planned Unit
Development District Review with waivers on 60.91 acres, direct Staff to prepare a Development Agreement incorporating Staff and Commission recommendations and Council conditions. Motion carried 5-0.
X. PAYMENT OF CLAIMS
MOTION: Nelson moved, seconded by Freiberg, to approve the payment of claims as submitted. Motion was approved on a roll call vote, with Freiberg, Narayanan,
CITY COUNCIL MINUTES April 16, 2024
Page 4
Nelson, Toomey and Case voting “aye.” XI. ORDINANCES AND RESOLUTIONS
XII. PETITIONS, REQUESTS, AND COMMUNICATIONS XIII. APPOINTMENTS
XIV. REPORTS
A. REPORTS OF COUNCIL MEMBERS B. REPORT OF CITY MANAGER
C. REPORT OF COMMUNITY DEVELOPMENT DIRECTOR D. REPORT OF PARKS AND RECREATION DIRECTOR
E. REPORT OF PUBLIC WORKS DIRECTOR
F. REPORT OF POLICE CHIEF G. REPORT OF FIRE CHIEF
H. REPORT OF CITY ATTORNEY XV. OTHER BUSINESS
XVI. ADJOURNMENT
MOTION: Narayanan moved, seconded by Toomey, to adjourn the meeting. Motion carried 5-0. Mayor Case adjourned the meeting at 7:19 p.m.
Respectfully submitted, ________________________
Sara Aschenbeck, Administrative Support Specialist
CITY COUNCIL AGENDA
SECTION: Consent Calendar
DATE:
May 7, 2024
DEPARTMENT/DIVISION:
Christy Weigel, Police/ Support Unit
ITEM DESCRIPTION:
Clerk’s License Application List
ITEM NO.:
VIII.A.
These licenses have been approved by the department heads responsible for the licensed activity. Requested Action Motion: Approve the licenses listed below
Gambling/Bingo Organization: The Preserve Association Place: Preserve Community Center Barn 11221 Anderson Lakes Pkwy
Date: August 10, 2024
CITY COUNCIL AGENDA
SECTION: Consent Calendar
DATE:
May 7, 2024
DEPARTMENT/DIVISION:
Community Development/Planning
Julie Klima/Jeremy Barnhart
ITEM DESCRIPTION:
Eden Prairie Ridge
ITEM NO.:
VIII.B.
Requested Action
Move to:
• Approve the 2nd Reading of an Ordinance for a Zoning District Change from Rural to R1-9.5 on 1.7 acres
• Approve the Development Agreement for Eden Prairie Ridge Synopsis This is the final reading for Eden Prairie Ridge. The applicant is requesting approval to divide one parcel into 2 single family lots and 1 outlot. The 1.7 -acre property is located at 9740 Eden
Prairie Road. The property is guided Low Density Residential, which allows a density of 0.1-5 units per acre. The proposed density of 1.2 units per acre is consistent with the Comprehensive Plan. Current zoning is Rural and the applicant is requesting a zoning district change to R1-9.5. The lots
conform to the R1-9.5 zoning standards. Outlot A will be deeded to the City for potential future access/road improvements should the improvements be necessary. The 120-day review period expires on May 22, 2024. Attachments 1. Ordinance for Zoning District Change 2. Summary of Ordinance
3. Development Agreement
EDEN PRAIRIE RIDGE
CITY OF EDEN PRAIRIE HENNEPIN COUNTY, MINNESOTA ORDINANCE NO. _-2024
AN ORDINANCE OF THE CITY OF EDEN PRAIRIE, MINNESOTA, REMOVING CERTAIN LAND FROM ONE ZONING DISTRICT AND PLACING IT IN ANOTHER, AMENDING THE LEGAL DESCRIPTIONS OF LAND IN EACH DISTRICT, AND ADOPTING BY REFERENCE CITY CODE CHAPTER 11 AND SECTION 11.99
WHICH, AMONG OTHER THINGS, CONTAIN PENALTY PROVISIONS THE CITY COUNCIL OF THE CITY OF EDEN PRAIRIE, MINNESOTA, ORDAINS: Section 1. That the land which is the subject of this Ordinance (hereinafter, the
“land”) is legally described in Exhibit A attached hereto and made a part hereof.
Section 2. That action was duly initiated proposing that the land be removed from the Rural Zoning District and be placed in the R1-9.5 Zoning District as described in Exhibit A.
Section 3. The proposal is hereby adopted and the land shall be and hereby is
removed from the Rural Zoning District and shall be included hereafter in the R1-9.5 Zoning District, and the legal descriptions of land in each Zoning District referred to in City Code Section 11.03, Subdivision 1, Subparagraph B, shall be, and are amended accordingly.
Section 4. City Code Chapter 1, entitled “General Provisions and Definitions
Applicable to the Entire City Code Including Penalty for Violation” and Section 11.99, “Violation a Misdemeanor” are hereby adopted in their entirety, by reference, as though repeated verbatim herein.
Section 5. The land shall be subject to the terms and conditions of that certain
Development Agreement dated as of May 7, 2024, entered into between The Pemtom Land Company, and the City of Eden Prairie, and which Agreement are hereby made a part hereof. Section 6. This Ordinance shall become effective from and after its passage and
publication.
FIRST READ at a regular meeting of the City Council of the City of Eden Prairie on the 12th day of March, 2024, and finally read and adopted and ordered published in summary form as attached hereto at a regular meeting of the City Council of said City on the 7th day of May, 2024.
ATTEST: _____________________________ _____________________________
David Teigland, City Clerk Ronald A. Case, Mayor
PUBLISHED in the Sun Sailor on__________________, 2024.
EXHIBIT A
Legal Description Prior to Final Plat
The land referred to in the Commitment is Torrens Property (Certificate No. 1361095) situated in the County of Hennepin, State of Minnesota and is described as follows: Par 1: That part of the South 225 feet of the Southeast Quarter of the Northeast Quarter of
Section 29, Township 116, Range 22, lying Westerly of Tract B, Registered Land Survey No.
465, Hennepin County, Minnesota. Par 2: The South 225 feet of the East 350 feet of the Southwest Quarter of the Northeast Quarter, Section 29, Township 116, Range 22, Hennepin County, Minnesota.
Land to be rezoned from Rural to R1-9.5
Legal Description After Final Plat
Lots 1 and 2, Block 1, Eden Prairie Ridge, Hennepin County, MN Outlot A, Eden Prairie Ridge, Hennepin County, MN
EDEN PRAIRIE RIDGE
CITY OF EDEN PRAIRIE HENNEPIN COUNTY, MINNESOTA
SUMMARY OF ORDINANCE NO. - 2024
AN ORDINANCE OF THE CITY OF EDEN PRAIRIE, MINNESOTA,
REMOVING CERTAIN LAND FROM ONE ZONING DISTRICT AND PLACING IT IN ANOTHER, AMENDING THE LEGAL DESCRIPTIONS OF LAND IN EACH DISTRICT, AND ADOPTING BY REFERENCE CITY CODE CHAPTER 1 AND SECTION 11.99, WHICH, AMONG OTHER THINGS, CONTAIN PENALTY PROVISIONS
THE CITY COUNCIL OF THE CITY OF EDEN PRAIRIE, MINNESOTA, ORDAINS: Summary: This ordinance allows rezoning of land located at 9740 Eden
Prairie Road from the Rural Zoning District to the R1-9.5 Zoning District. Exhibit A,
included with this Ordinance, gives the full legal description of this property. Effective Date: This Ordinance shall take effect upon publication.
ATTEST:
___________________________ _____________________________
David Teigland, City Clerk Ronald A. Case, Mayor PUBLISHED in the Sun Sailor on__________________, 2024.
(A full copy of the text of this Ordinance is available from City Clerk.)
CITY COUNCIL AGENDA
SECTION: Consent Calendar
DATE:
May 7, 2024
DEPARTMENT/DIVISION: Julie Klima, Community Development Director; Jeanne Karschnia, Housing
Services Coordinator
ITEM DESCRIPTION: Resolution approving the participation of the Hennepin County Housing and Redevelopment Authority in Eden Prairie affordable housing
projects.
ITEM NO.: VIII.C.
Requested Action Move to: Adopt resolution approving participation of the Hennepin County Housing and
Redevelopment Authority in Eden Prairie affordable housing projects using the Affordable Housing Incentive Fund (AHIF) for West Hennepin Affordable Housing Land Trust (WHAHLT).
Background
The City has agreed to use Community Development Block Grant funds to assist with the purchase of Eden Prairie properties by West Hennepin Affordable Housing Land Trust (WHAHLT).
WHAHLT has also been approved to receive AHIF funding for these projects by the Hennepin County Housing and Redevelopment Authority (HCHRA). The HCHRA needs City Council approval in order to go forward with the funding and
completion of the financing for the projects.
Attachment Resolution
CITY OF EDEN PRAIRIE HENNEPIN COUNTY, MN
RESOLUTION NO. 2024-__ RESOLUTION APPROVING THE PARTICIPATION OF THE HENNEPIN COUNTY HOUSING AND REDEVELOPMENT AUTHORITY IN AN AFFORDABLE HOUSING
PROJECT
WHEREAS, the Hennepin County Housing and Redevelopment Authority (HCHRA) has approved the use of a $175,000 Affordable Housing Incentive Fund (AHIF) loan for West
Hennepin Affordable Housing Land Trust (WHAHLT), dba Homes Within Reach contingent
upon the Eden Prairie City Council’s consent to the HCHRA’s participation in the project. WHEREAS, The purchase of up to ten homes to be acquired for the WHAHLT program, of which one or more properties may be located within the city of Eden Prairie and the rest within
suburban Hennepin County, will preserve the supply of affordable housing in the city by
providing long-term affordability. WHEREAS, AHIF from the HCHRA will complete the financing required for the project to go forward.
BE IT RESOLVED that the participation of the Hennepin County Housing and Redevelopment Authority in the project for the limited purpose of providing financial support to the project is hereby approved.
BE IT FURTHER RESOLVED that nothing in this resolution shall create a pecuniary
obligation of the City to assist the project, nor shall the City be in any way responsible for any financing obligation or agreement of the HCHRA with respect to its provision of financial assistance to the project.
BE IT FURTHER RESOLVED that nothing in this resolution is intended to endorse the merits
of the Projects to be undertaken. ADOPTED by the City Council of the City of Eden Prairie this 7th day of May, 2024.
_________________________
Ronald A. Case, Mayor
ATTEST: __________________________ David Teigland, City Clerk
CITY COUNCIL AGENDA
SECTION: Consent Calendar
DATE:
May 7, 2024
DEPARTMENT / DIVISION:
Matt Sackett
Police Department
ITEM DESCRIPTION:
Approval of an Application to Conduct Off-Site Gambling for Eden Prairie Hockey Association
ITEM NO.:
VIII.D.
Requested Action Move to: Approve Resolution Approving the Application to Conduct Off-Site Gambling for
Lawful Gambling to be Conducted by the Eden Prairie Hockey Association at Schooner
Days Synopsis
The Eden Prairie Hockey Association (EPHA) recently approached the City regarding its desire to sell
pull-tabs at Schooner Days, a community festival occurring May 31-June 2, 2024 at Round Lake Park. The EPHA is working with the Eden Prairie Lions Club, Schooner Days organizer. EPHA currently has Premises permits for three locations within the City: Champps, Old Chicago and X-
Golf. State law allows an organization to conduct lawful gambling on a premises other than its permitted
premises for up to 12 special events in a calendar year. City approval is necessary before EPHA’s application can be submitted to the Gambling Control Board. EPHA must still complete the application process and obtain approval from the Gambling Control Board
before any lawful gambling may occur at this event.
EPHA has met the requirements of City Code § 5.40 and staff recommends approval of the Application to Conduct Off-Site Gambling at Schooner Days, at Round Lake Park. This same permit was approved on May 2, 2023 by council for the 2023 Schooner Days Event.
Attachment Resolution
CITY OF EDEN PRAIRIE HENNEPIN COUNTY, MINNESOTA
RESOLUTION NO. 2024-__ A RESOLUTION APPROVING AN APPLICATION TO CONDUCT OFF-SITE GAMBLING FOR LAWFUL GAMBLING TO BE CONDUCTED
BY THE EDEN PRAIRIE HOCKEY ASSOCIATION AT SCHOONER DAYS WHEREAS, Eden Prairie Hockey Association holds premises permits and is licensed to conduct lawful gambling at three locations in the City of Eden Prairie.
WHEREAS, Eden Prairie Hockey Association is submitting an application to the Minnesota
Gambling Control Board for approval of an Application to Conduct Off-Site Gambling at Schooner Days, a Community Festival occurring May 31–June 2, 2024 at Round Lake Park, 16691 Valley View Road, Eden Prairie, MN 55346.
WHEREAS, Eden Prairie Hockey Association will be responsible for operating and managing the
lawful gambling activity and must comply with all applicable requirements of state law and Eden Prairie City Code § 5.40. NOW, THEREFORE, BE IT RESOLVED by the City Council of the City of Eden Prairie,
Minnesota that, pursuant to Minnesota Statutes Sections 349.165, subd. 5 and 349.213, subd. 2
and Eden Prairie City Code § 5.40, the City Council does hereby approve the Application to Conduct Off-Site Gambling for the Eden Prairie Hockey Association to conduct lawful gambling at Schooner Days, a community festival occurring May31-June 2, 2024 at Round Lake Park and directs the City Clerk to certify a copy of this resolution for Eden Prairie Hockey Association for
inclusion with the state application.
ADOPTED by the Eden Prairie City Council this 7th day of May, 2024.
_________________________ Ronald A. Case, Mayor ATTEST:
_______________________________ David Teigland, City Clerk
CITY COUNCIL AGENDA
SECTION: Consent Calendar
DATE:
May 7, 2024
DEPARTMENT/DIVISION:
Scott Gerber, Fire Chief
ITEM DESCRIPTION:
Adopt Hennepin County Fire Chiefs Association Membership
ITEM NO.:
VIII.E.
Requested Action
Move to: Adopt Resolution approving membership in the Hennepin County Fire Chiefs Association. Synopsis
Hennepin County Fire Chiefs Association (“HCFCA”) has been re-organized/updated and now requires a new resolution for membership. The HCFCA Board discussed the relative merits of organizing as a joint powers entity under Minn. Stat. § 471.59 or a nonprofit corporation, and ultimately decided to move forward as a nonprofit to provide maximum flexibility in its authorized activities and members.
Background Information The Hennepin County Fire Chiefs Association (“HCFCA”) is a group of fire departments and other organizations in the fire service industry in Hennepin County that provides cooperation, education,
and training regarding fire service and emergency response in the county. While historical documentation is sparse, it appears that HCFCA was formed in the early 1960s, but no records exist suggesting that the group has ever been incorporated or recognized as a formal entity with the Minnesota Secretary of State.
In early 2023, HCFCA’s Board of Directors began an effort to formalize the group’s organizational status, including ensuring that it is meeting state and federal tax obligations. The Board engaged an attorney to advise it on organizational matters. The Board discussed the relative merits of organizing as a joint powers entity under Minn. Stat. § 471.59 or a nonprofit corporation, and ultimately decided to move forward as a nonprofit to provide maximum flexibility in its authorized
activities and members. In making this decision, the Board looked to the organizational structure of the Minnesota State Fire Chiefs Association, which is also organized as a nonprofit. The Board intends to apply to the IRS for tax-exempt status as a 501(c)(6) business association. In order to document each Fire Department’s membership in the new nonprofit corporation,
counsel advised that each member City adopt a resolution officially approving membership in HCFCA. The resolution is attached. Attachments Resolution
CITY OF EDEN PRAIRIE
HENNEPIN COUNTY, MINNESOTA RESOLUTION NO. 2024-__ A RESOLUTION APPROVING MEMBERSHIP IN THE HENNEPIN COUNTY FIRE
CHIEFS ASSOCIATION, INC. WHEREAS, the Hennepin County Fire Chiefs Association (“HCFCA”) is an organization of fire departments and others in the fire service industry in Hennepin County whose purpose is to provide a forum to discuss and promote fire safety, to exchange ideas and search for solutions to
fire safety and other emergency response problems, to conduct research, to facilitate educational
programs, to promote legislation, and to promote the spirit of cooperation between fire departments or other emergency response organizations operating within Hennepin County, Minnesota; and WHEREAS, HCFCA was established as an association in 1961 but was not a formal
corporate entity recognized by the Office of the Minnesota Secretary of State;
WHEREAS, the City of Eden Prairie is a currently a member of HCFCA; WHEREAS, HCFCA’s membership and Board of Directors has determined that it is in
the best interests of the association to organize as a nonprofit corporation in order to formalize its
operations and provide the option of applying for federal tax-exempt status; WHEREAS, on January 8, 2024, the Hennepin County Fire Chiefs Association, Inc., was registered as a nonprofit corporation with the Office of the Minnesota Secretary of State;
WHEREAS, Minnesota Statutes Section 471.96 provides authority for cities and counties “to appropriate necessary funds to provide membership of their respective municipal corporations or political subdivisions respectively in county, regional, state, and national associations of a civic, educational, or governmental nature which have as their purpose the betterment and improvement
of municipal government operations”; and
WHEREAS, City of Eden Prairie membership in the HCFCA as a nonprofit organization will benefit the City of Eden Prairie and its Fire Department and will provide for the betterment and improvement of City of Eden Prairie operations surrounding fire safety and emergency
response;
NOW THEREFORE BE IT RESOLVED by the City of Eden Prairie City Council as follows:
1. City of Eden Prairie membership in Hennepin County Fire Chiefs Association, Inc. is
approved and payment of annual membership dues is authorized.
2
2. Membership will be through the Fire Department and Scott Gerber, Fire Chief, is designated as City of Eden Prairie’s representative to HCFCA.
ADOPTED, by the City of Eden Prairie City Council on the 7th day of May, 2024.
________________________
Ronald A. Case, Mayor ATTEST:
_________________________ David Teigland, City Clerk
CITY COUNCIL AGENDA
SECTION: Consent Calendar
DATE:
May 7, 2024
DEPARTMENT / DIVISION:
Fire Department
Steve Kartak, Building Official
ITEM DESCRIPTION:
Resolution Ordering the Removal of Hazardous Building Located at 17391 Rustic Hills Drive, Eden Prairie, Minnesota
ITEM NO.:
VIII.F.
Requested Action
Move to: Adopt a Resolution Ordering the Removal of Hazardous Building Located at 17391
Rustic Hills Drive, Eden Prairie, Minnesota Synopsis
The home located at 17391 Rustic Hills Drive was severely damaged by a fire on April 14, 2023. The
City’s Building Official conducted an inspection that confirmed that the building is structurally unsafe and must be demolished. The Building Official sent a letter to the owner of the building on April 8, 2024 requiring that the building be demolished and all debris removed on or before April 30, 2024. The letter advised the owner that the City will proceed in declaring the building as hazardous and order its removal
if action is not taken by April 30, 2024. To date, the owner has failed to respond to the City or remove
the building as required. The building is a hazard due to the extensive physical and structural damage which poses a risk to public safety. The removal of this building and all debris will preserve public safety.
Minnesota Statutes Chapter 463 provides a process whereby the City Council can declare a property or building to be hazardous and require corrective action. If action is not taken within the prescribed timeline, the City may request a court order allowing the City to enter the property, correct the hazardous condition, and specially assess its costs incurred in doing so against the property. The
attached resolution is the first step in this process.
Attachment
Resolution with attached Exhibit A
CITY OF EDEN PRAIRIE HENNEPIN COUNTY, MINNESOTA
RESOLUTION NO. 2024-____ A RESOLUTION ORDERING THE REMOVAL OF THE HAZARDOUS BUILDING LOCATED AT 17391 RUSTIC HILLS DRIVE, EDEN PRAIRIE, MINNESOTA Pursuant to Minn. Stat. §§ 463.15–463.261, the City Council of the City of Eden Prairie finds the building located at 17391 Rustic Hills Drive, Eden Prairie, Minnesota (the “Building”), on the property legally described as Lot 7, Block 8, Woodlawn Heights, Hennepin County,
Minnesota, (the “Property”), to be a hazardous building for the following reasons:
1. Creative Builders Wizards L.L.C. (“Owner”) is the record owner of the Property and
the Building thereon. There is one mortgage filed against the Property held by Clear
Creek Farms LLC (“Mortgagee”).
2. The Building was severely damaged by a fire that occurred on or about April 14, 2023.
3. The damage to the Building includes, but is not limited to; severe damage to the upper-
level walls and ceiling, charring to the exterior and interior wall framing members,
charring of the ceiling and floor rafters, charring of the roof decking, front wall damage
to the extent collapse is possible, heat and smoke damage to the plumbing, electrical,
and mechanical systems, severe damage to the vinyl siding along all sides of the
Building, and ninety-five percent (95%) destruction of the attached garage.
4. The Building has been exposed to the exterior elements for approximately twelve (12)
months which has caused further structural instability.
5. The Building was inspected on April 4, 2024. The condition of the Building is fully
documented in the Fire Damage Report dated April 4, 2024, a copy of which is attached
to this resolution as Exhibit A.
6. The City Building Official sent a letter to Owner dated April 8, 2024 requiring that the
Building be removed and all debris removed on or before April 30, 2024, and Owner
has failed to comply.
7. The Building is a hazardous building as defined by Minn. Stat. § 463.15, subd. 3, due
to the extensive physical and structural damage which constitutes a hazard to public
safety. The Building must be razed and all debris removed to preserve public safety.
2
NOW, THEREFORE, BE IT RESOLVED AND ORDERED BY THE CITY COUNCIL
OF THE CITY OF EDEN PRAIRIE, MINNESOTA, AS FOLLOWS:
1. That pursuant to the foregoing findings and in accordance with Minn. Stat. §§
463.15–463.261, the Council orders that the Building located at 17391 Rustic Hills
Drive, Eden Prairie, Minnesota is a hazardous building and must be razed and all
debris be removed from the Property.
2. That the razing of the Building and removal of debris must be completed within
thirty (30) days after this Order is served upon the Owner and the Mortgagee and
any other lienholders of record as determined by the City Attorney.
3. That a motion for summary enforcement of the Order will be made to the Hennepin
County District Court unless corrective action is taken, or unless an answer is filed
within the time specified in Minn. Stat. § 463.18, which is twenty (20) days.
4. That if the City must take action to enforce this Order and remove the Building, all
enforcement and removal costs, including reasonable attorneys’ fees, will be
specially assessed against the Property and collected in accordance with Minn. Stat.
§§ 463.151, 463,161, 463.21, and 463.22.
5. That the City Attorney is authorized to serve this Order upon Owner, Mortgagee,
and any other lienholders of record.
6. That the City Attorney is authorized to proceed with the enforcement of this Order
as provided in Minn. Stat. §§ 463.15–463.261.
ADOPTED by the City Council of the City of Eden Prairie on May 7, 2024.
___________________________ Ronald A. Case, Mayor ATTEST: ___________________________ David Teigland, City Clerk
3
EXHIBIT A
April 4, 2024 Inspection Report and Photos
Fire Damage Report-Structural Observa�on
4/4/2024
Property Informa�on:
1. Address: 17391 Rus�c Hills Drive, Eden Prairie MN 55346.
2. The fire was on April 4th, 2023.
3. The property is owned by Yarco Tahirou.
4. The home was built in 1983.
A visual inspec�on of the interior was conducted with the following observa�ons (Photos):
1. The upper-level walls and ceilings are severely damaged.
2. The damage consists of charring to exterior and interior wall framing members.
3. The ceiling and floor ra�ers show severe signs of charring.
4. Roof decking on the underside shows signs of charring.
5. The front wall is severely damaged to the point collapsing is possible.
6. The floor deck was charred and damaged.
7. The fire damage extended from the garage throughout the home.
8. All plumbing, electrical, and mechanical show signs of heat and smoke damage.
A visual inspec�on of the exterior revealed the following observa�ons (In-person and photos):
1. The front of the main exterior structure appears damaged beyond repair. Exterior sheathing,
insula�on, and interior gypsum board is damaged or gone. The exterior wall studs show signs of severe
charring.
2. There were signs of damage to the vinyl siding along all sides of the home.
3. The exterior framing is severely damaged on all sides of the home.
4. The roof is structurally damaged.
5. The atached garage is 95% destroyed. What’s le� of the exterior walls is severely charred.
6. The fire completely burned through the roof assembly of the garage.
7. The exterior bracing of the home is structurally compromised due to the loss of the exterior and
interior sheathing, also known as braced walls. The braced walls provide lateral and shear strength to
the structure. Without them, the home is subject to lateral collapse.
A visual inspec�on of the a�c revealed the following observa�ons (Photos):
1. The roof framing consisted of engineered trusses, which are built using gusset plates to atach the
truss webbing together. Under high heat these gussets plates will fail causing the roof to collapse.
2. The ra�ers are severely charred and damaged.
3. The roof deck was severely damaged and charred.
A visual inspec�on of the basement revealed the following (Photos):
1. The founda�on consists of masonry block
2. Photos show signs of water and smoke damage to the walls and ceilings.
3. The wood beams show severe signs of charring.
5. The floor framing adjacent to the garage is severely damaged and charred.
6. The home has been open to the exterior elements for approximately 12 months. During the winter
months the cold temperatures may have caused structural deficiencies to the founda�on. This happens
when the frost gets under the foo�ngs and causes them to heave.
Conclusion:
Fire damage to the wood structural members consists of smoke damage, severe degrada�on of wood
structural members, charring, and failure of fasteners. Based on the physical condi�ons observed, I
approximate that 85% of the overall structure has been severely damaged from the fire and the integrity
has been structurally compromised. I believe that the structure is not salvageable and recommend the
structure be demolished as soon as possible.
Signature:
Building Official
City of Eden Prairie
2
3
4
Requested Action
Move to: Adopt Resolution Authorizing Settlement and Acquisition of Permanent Easement for Roadway, Drainage and Utility Easements and a Temporary Construction Easement Acquisitions for Parcel 3 on the West 70th St. Improvement Project.
Synopsis Subject to Council approval, a proposed settlement agreement has been reached regarding the acquisition of a permanent easement for roadway, drainage and utility purposes and a temporary
construction easement relating to property located at 6968 Shady Oak Road, Eden Prairie, MN 55344 (the “Property”). The settlement includes all claims and costs associated with the acquisition. Background Information
The City has commenced a condemnation action in Hennepin County District Court related to Project No.19810, which is commonly known as the West 70th St. Improvement project (the “Project”). The Project includes acquiring permanent and temporary easements over and across the Property for the purposes of the City’s improvements to West 70th Street.
On November 27, 2023, the Council authorized acquisition of the necessary permanent and temporary construction easements on the Property for $97,200.00, which was based on an appraisal obtained by the City. The Property owner rejected the City’s appraisal valuation, and after further negotiation and consultation, the City Attorney and City Engineer recommend that
the City Council agree to settle for the sum total of $145,000.00. The settlement amount includes
acquisition of all easements, all allowable statutory fees and costs, including appraisal and attorney’s fees. Upon settlement, the City will save additional legal fees, expert witness fees, and commissioner
fees associated with a commissioners’ hearing, and potential future litigation and potential appeal
costs. Staff recommends approval of the settlement agreement. Attachments
Resolution
Settlement Agreement and Easements
CITY COUNCIL AGENDA
SECTION: Consent Calendar
DATE:
May 7, 2024
DEPARTMENT/DIVISION:
Carter Schulze
Public Works/Engineering
ITEM DESCRIPTION: I.C. 19810
Adopt Resolution Authorizing Settlement of Easement Acquisitions for Parcel 3 for the West 70th St.
Improvement Project
ITEM NO.:
VIII.G.
CITY OF EDEN PRAIRIE HENNEPIN COUNTY, MINNESOTA
RESOLUTION NO. 2024-__ RESOLUTION AUTHORIZING SETTLEMENT OF ACQUISITION FOR PERMANENT AND TEMPORARY EASEMENTS FOR THE WEST 70TH STREET IMPROVEMENT
PROJECT, CITY PROJECT NO.: 19810 WHEREAS, the City of Eden Prairie (“City”) commenced a condemnation action related to project number I.C. 19810, commonly known as the West 70th Street Improvement project (the “Project”);
and
WHEREAS, the Project included taking permanent and temporary easements from a parcel located in Eden Prairie and commonly known as 6968 Shady Oak Road, Eden Prairie, Minnesota (“Property”); and
WHEREAS, the City previously authorized acquisition of the easements for the sum total of $97,200.00 based upon an appraisal valuation; and WHEREAS, the Property owner rejected the City’s appraisal valuation; and
WHEREAS, after negotiations between the parties, the City Engineer and City Attorney recommend settlement pursuant to the terms of the settlement agreement attached hereto as Exhibit A, which includes all statutory allowable claims and costs associated with the easement acquisition.
NOW, THEREFORE, BE IT RESOLVED by the Eden Prairie City Council:
1. The Recitals set forth above are incorporated herein; 2. The City Council authorizes and approves the execution of the settlement agreement and easements attached hereto as Exhibit A.
ADOPTED by the Eden Prairie City Council on May 7, 2024.
___________________________
Ronald A. Case, Mayor ATTEST:
___________________________
David Teigland, City Clerk
2
EXHIBIT A (Settlement Agreement)
CITY COUNCIL AGENDA
SECTION: Consent Calendar
DATE:
May 7, 2024
DEPARTMENT/DIVISION:
Carter Schulze
Public Works / Engineering
ITEM DESCRIPTION: I.C. 17-5990
Order Petitioned Improvements and Include in Preparation of Plans and Specifications for Dell Road Street and Utility Improvements
ITEM NO.:
VIII.H.
Requested Action
Move to: Adopt resolution ordering petitioned improvements and include in preparation of plans and specifications for Dell Road Street and Utility Improvements Synopsis
The City Council ordered the Dell Road improvements on January 16, 2024. The petition for the private culvert work was received that same day and received on February 6, 2024 and by resolution, the City Engineer was instructed to amend the Dell Road Feasibility Report and present the updated report to the City Council at a later date.
Based on the Amended Dell Road Feasibility Report, it is determined that the petitioned improvements are necessary, feasible and cost effective and in combining these private improvements with the overall Dell Road improvements, there will be efficiencies of scale in the work due to proximity of the two projects and their similar work. It is therefore recommended that the City Council direct staff to proceed with the project on a schedule similar to the one
suggested in the report. Financial Implications The total estimated cost of the private culvert improvements are $188,300 and are shown as
divided among the 5 properties directly benefitting the work in the amended preliminary assessment roll. Attachments
Feasibility Report Resolution
CITY OF EDEN PRAIRIE DELL ROAD - Crestwood Terrace to Connection North of Flying Cloud Drive (CSAH 61) FEASIBILITY REPORT – AMENDED APRIL 2024 Street and Utility Improvements Improvement Contract No. 17-5990 Prepared by: City of Eden Prairie Public Works Department
Engineering Division 8080 Mitchell Road Eden Prairie, MN 55344 Assisted by: WSB 540 Gateway Blvd Burnsville, MN 55337
Page 2 TABLE OF CONTENTS REPORT COVER TABLE OF CONTENTS CERTIFICATION REPORT CONTENT I. INTRODUCTION II. STREET AND TRAIL IMPROVEMENTS III. STORM DRAINAGE IMPROVEMENTS IV. SANITARY SEWER AND WATERMAIN IMPROVEMENTS V. PROJECT COST SUMMARY VI. CONCLUSIONS AND RECOMMENDATIONS PUBLIC HEARING NOTICE PROJECT SCHEDULE TABLE NO. 1 - ESTIMATED COSTS PRELIMINARY ASSESSMENT ROLL PROJECT ASSESSMENT AND AREA MAPS Figure No. 1 IMPROVEMENT AREA / ASSESSMENT BOUNDARY Figure No. 2 STREET AND TRAIL IMPROVEMENTS Figure No. 3 STORM DRAINAGE IMPROVEMENTS Figure No. 4 SANITARY SEWER AND WATERMAIN IMPROVEMENTS
Page 3
CERTIFICATION I hereby certify that this report was prepared by me or under my direct supervision and that I am a duly
registered Professional Engineer under the laws of the State of Minnesota. Carter Schulze, PE Reg. No. 44908 Date
Page 4 I. INTRODUCTION This report presents the results of a preliminary engineering study for street and utility improvements on Dell Road from Crestwood Terrace to approximately 580-feet north of CSAH No. 61 (Flying Cloud Drive) (Improvement Area). This feasibility study was authorized by the Eden Prairie City Council on March 15, 2022. The street and trail improvements described in this report will provide for a safer vehicular and pedestrian friendly connection to Flying Cloud Drive by reconstructing the existing unimproved narrow roadway which has sharp curves, steep grades and poor sight lines. The utility improvements will provide access to City sanitary sewer and water for the residential properties along Dell Road and future connection opportunity along Turnbull Road. The Improvement Area (in the southwest quadrant of the City) is within Section 29 and 30, Township 116, Range 22 and is shown on Figure No. 1. The Eden Prairie City Council ordered the preparation of this feasibility study for the Dell Road area on March 15, 2022. This council action was approved without a petition so therefore, any council action related to this project will require a 4/5ths approval of the City Council. Work on upgrading this rural gravel section of roadway has been ongoing since 2006. Most recently on July 20, 2021, a neighborhood meeting was held to discuss the project and its complexities. Assessments, traffic and changing of the area were the largest concerns from the group. This report identifies properties deriving benefit from the proposed improvements. The proposed street improvements described later in this report will provide benefit to the adjacent residential properties, as well as the residential properties that take access off of Dell Road. The proposed sanitary sewer and water improvements will provide benefit to many of the same residential properties described above as it will provide the benefitting properties with the ability to connect to individual service lines, obtain access to City utilities directly (or with mainline extensions), or at the time of future development for some of the larger parcels. For the identified Improvement Area, we estimate a total of 78 residential units, which includes potential developable units for properties along Dell Road and Turnbull Road. Later in this report, the proposed assessment rates will be described for each benefitting component of the proposed improvements. The parcel acreage, potential units, estimated assessments, connection fees, etc. is shown on the attached Preliminary Assessment Roll. II. STREET AND TRAIL IMPROVEMENTS The street and trail segments proposed for improvement are shown on Figure No. 1. The existing road within the project area varies between a typical city collector section with curb and gutter, a narrow rural paved section and a narrow gravel section. The narrow gravel and rural paved sections make up most of the Improvement Area. An improved street with adequate structure, storm drainage and pedestrian facilities is needed to support the residential development that has and is occurring in this area as well as provide safer curves and flatter grades on a slightly adjusted horizontal alignment. This segment of Dell Road is functionally classified as a major collector and is on the City’s municipal state aid system. The recommended street section is a 32-foot wide (as measured from back-of-curb to back-of-curb) urban two-lane road with concrete curb and gutter. A new eight-foot bituminous trail separated by a
Page 5 5-foot turf boulevard is proposed along the west/south side that will extend the existing trail on Dell Road southerly to the existing trail along Flying Cloud Drive that was completed as part of the County’s CSAH 61 project in 2020. The County’s project provided an improved three-lane county highway with a ten-foot bituminous trail along the north side. As part of the County’s project, the intersection with Dell Road was raised to accommodate a safer approach to Flying Cloud Drive from Dell Road. The proposed Dell Road will be designed to meet MnDOT State Aid Standards including both vertical and horizontal curves. Vertical grades will aim to be less than or equal to 10% throughout with horizontal curves meeting a 30-mph design, but a variance may be required considering the constraints
within the existing corridor. The City’s typical collector street section is estimated to include 1.5-inch
bituminous wear course, 2-inch bituminous base course, 10-inches of Class 5 aggregate base and an 18-
inch sand section. The proposed trail is to be 2.5-inches of bituminous pavement over 8-inches of Class
5 aggregate base. The final street and trail section recommendations will be made following a
geotechnical evaluation to be completed with the final design phase of the project. The intersection of Dell Road and Turnbull Road will be reconstructed with the landing of Turnbull
Road improved for a safer intersection as Turnbull Road currently approaches Dell Road at a
downslope. It is intended that the proposed curb on Dell Road will wrap around to Turnbull Road, but
no further curb improvements will extend on Turnbull Road. Bituminous improvements involved with
flattening the grade are anticipated with the project and could extend approximately 200-feet to the east. The varied terrain throughout the corridor will require construction of retaining walls to reduce impacts
to adjacent properties as compared to graded slopes outside of the roadway section. Retaining walls are
proposed as precast large block modular gravity walls estimated at 5 to 20-feet in height, however,
alternative wall designs built to lessen construction limits could be required during final design. Where
retaining walls are not necessary, slopes will be constructed to maximum 3H:1V to tie-in to existing
ground.
The proposed street and trail assessments for the adjacent and accessing properties along Dell Road will be based on the cost of an equivalent 28-foot residential street with an eight-foot bituminous trail along the west and south side of the road. The assessable street cost will include only the portion of the roadway and trail from the north tie-in point on Dell Road (where the curb and gutter improvements end) to a point approximately 300 feet south of Turnbull Road not including approximately 400 feet of the Riley Creek/floodplain area. This is shown on Figure No. 2 . The remainder of the costs for the new roadway and trail to Flying Cloud Drive, as well as the extra roadway width, retaining walls, culvert crossing and grading is proposed to be a City cost. The estimated construction cost for the street and trail improvements, including grading, retaining walls and a 10% contingency, is $4,400,000. The estimated total project cost for street and trail improvements including 25% for engineering and testing for the City portion and an additional 10% for the assessable portion (due to additional administration and interim financing costs) is $5,600,000. The estimated total project cost for the assessable portion of street and trails is $1,203,100. The assessable costs are made up of a current assessment rate per unit of $16,300. Previously developed/or divided properties within the Improvement Area have pending development agreement assessments for Dell Road Improvements totaling $9,800 per unit dating back to 2003. The balance of the street, trail, grading, and retaining wall costs (estimated at $4,396,900) will be funded with Municipal State Aid funds.
Page 6 The proposed street and trail assessment rate is based on the potential of 69 residential lot units (not including the 9 units of previous pending assessments) that are adjacent or take access from this portion of the roadway. This is the most equitable method of distributing street improvement costs due to the variable frontages, unique geography and limited access points of the benefitting properties. The proposed assessment for the street improvements for each parcel is shown on the Preliminary Assessment Roll. III. STORM DRAINAGE IMPROVEMENTS The existing corridor is a rural roadway relying on ditches and sheet flow to drain stormwater and a 72”
corrugated metal pipe culvert conveying Riley Creek from west to east under Dell Road. The southerly 500 feet of Dell Road was reconstructed as part of the Flying Cloud Drive improvements in 2020 and included raising the intersection and adding curb and gutter with storm sewer that discharges directly into a wetland that ultimately flows to Rice Lake south of Flying Cloud Drive. All rate control and water
quality improvements associated with the Flying Cloud Drive reconstruction project were aggregated
within a filtration BMP located approximately 0.5 miles west of the Dell Rd Intersection near the
entrance to Richard T. Anderson Park. A small rate control basin was constructed in the southwest
corner of the Dell Road and Riley Creek crossing by the city in 2016 to stabilize an eroding bank. The construction of an urban roadway section will require storm sewer to convey and treat drainage.
Riley Creek has a history of erosion due largely to uncontrolled Dell Road runoff. The proposed drainage system will split discharge with a portion of the drainage to Riley Creek and a portion to drainage basins near Flying Cloud Drive. Storm water will be treated by an infiltration BMP located on
the east side of Dell Road just south of Riley Creek, in accordance with requirements from the Riley-
Purgatory-Bluff Creek Watershed District (RPBCWD). The project exists within both the RPBCWD
and the Lower Minnesota River Watershed District (LMRWD), and as such must be permitted with each
watershed district (refer to Figure No. 3 for proposed storm drainage improvements). In addition to the proposed drainage system associated with the urban roadway improvements, the
project also includes the replacement of the 72” corrugated metal pipe culvert carrying Riley Creek
under Dell Road. A concrete box culvert meeting RPBCWD rules and municipal state aid standards is
proposed for the replacement. This work will likely be done under a road closure due to its deep
excavation and associated construction limits. The shared private driveway that serves five homes within the Meadowcroft and Doyle addition
developments intersects Dell Road north of Riley Creek. The private driveway traverses south to the
homes, and in doing so, crosses Riley Creek. This report analyzes the cost and feasibility of lining the
existing private culvert which conveys the creek. The City has been approached by a representative of
the development’s requesting improvements to the culvert be completed as a part of the City’s Dell
Road improvements and the costs specially assessed to the benefitting properties. Cured in place pipe lining of the culvert is being considered as an alternative to completely replacing the culvert in an effort to minimize the restoration costs that would typically accompany a deep, open trench excavation of the
culvert while still improving the structural integrity of the culvert. The estimated costs of the private
improvements are $188,300. This project component will be bid and costs tracked separately from all
other Dell Road improvements and will be 100% assessed back to the benefitting units upon receipt of a
petition and signing of a special assessment agreement. See Figure No. 3 showing private improvements
and related parcels.
Page 7 On January 16, 2024 the City received the signed petition representing 100% of the neighbors who would be assessed for the private culvert work. This petition was received by City Council on February
6, 2024 and a resolution was adopted to amend this report to include the assessable costs of the private culvert rehabilitation on the preliminary assessment roll and bring the report back to Council for approval. With the poor condition of the culvert, there is the possibility that the work could be done
prior to the overall Dell Road improvements in an emergency situation. This, however, could still be
accomplished by the City and the costs assessed to the residents. As shown in Table No. 1, the total construction cost for storm drainage (the private storm sewer work shown separately) is $1,067,600. The storm sewer infrastructure improvements and the treatment/infiltration facilities will be funded with a combination of Municipal State Aid and storm water utility funds. IV. SANITARY SEWER AND WATERMAIN IMPROVEMENTS Sanitary Improvements This feasibility report considered several options to extend sanitary sewer south of the Riley Creek
crossing that would serve not only those properties along Dell Road, but also future development needs
in the area, specifically along Turnbull Road. The recommended option is the construction of a public lift station. The public lift station is proposed to
be sited north of Riley Creek near the low point in the alignment and will pump wastewater through a 4” forcemain west and north to the existing sanitary sewer manhole located just south of the improved Dell Road section. The construction of 8” PVC gravity sewer would extend from the lift station southeast
along Dell Road to Turnbull Road, and in the future, to the east within Turnbull Road to the last parcel
able to be served via a gravity system (approximately 10001 Dell Road). 4” PVC sanitary sewer services
are proposed to be stubbed to each property along Dell Road as applicable. The lift station is proposed
as a submersible dual-pump system with controls meeting City of Eden Prairie public works
requirements. Figure No. 4 illustrates the public lift station layout as well as future utility installations. Other options to extend sanitary sewer within Dell Road and along Turnbull Road in the future included low pressure 3” sanitary forcemains where each homeowner would connect to the forcemain with privately owned grinder pumps. Extension of the forcemains extended both east to the existing Beverly
Drive sanitary system and west to the existing sanitary system on Dell Road. In the interest of best serving all the properties along Dell Road and along Turnbull Road equitably in
the future, the recommended sanitary sewer option is the public lift station. That will provide gravity
sanitary sewer options for properties along Turnbull Road in the future. This doesn’t eliminate the
possibility of private grinder pumps needed along Turnbull Road as many of the existing properties have
their septic systems located downhill from the roadway. Gravity options would still exist from the end of
the Beverly Drive system and the Reeder Ridge development to capture the parcels at the end of
Turnbull Road that are unable to reach the Dell Road system by gravity. Watermain Improvements Watermain improvements consist of the extension of 12” trunk watermain in Dell Road from the
Page 8 existing stub near Crestwood Terrace to Turnbull Road, connection to the Meadowcroft stub, and termination of the watermain extension at Turnbull Road with a hydrant and stub towards Turnbull Road
at the terminus. Connection to the City’s watermain at Meadowcroft and extension of the proposed 12”
trunk watermain along Turnbull Road in the future will both complete necessary watermain loops and
improve water quality and reliability for the City’s distribution system. Figure No. 4 illustrates the proposed watermain layout. Water services of 1-inch are proposed along the watermain length to service existing parcels, as
applicable, and also the future subdivision of parcels. Hydrants and gate valves are proposed along the
length of watermain to provide better fire protection and maintenance ability. Analysis of the trunk watermain indicates a high-pressure potential at the Riley Creek crossing, estimated to be about 110 psi. A valve, hydrant and manhole for pressure monitoring at this low point
have been included in the opinion of probable cost for maintenance purposes. V. PROJECT COST SUMMARY Table No. 1 summarizes the estimated costs for the various components of the project. These costs are based upon anticipated construction costs assuming adequate subsurface soil conditions, as well as a 10% contingency, 25% estimated engineering and testing costs, 9% administration fee, and 1% interim financing costs. Any right-of-way or easement costs associated with this project are not included in any cost estimates. These unknown costs will become project costs determined during final design and will be funded with Municipal State Aid funds. Any homesteaded properties that are generally un-developed will be granted a deferment of all assessments except an equivalent single unit of street and trail assessment until the property subdivides based on the City’s Special Assessment Policy. Non-homesteaded parcels will be granted a deferment on all assessments until the time of development or connection. Since homesteaded and non-homesteaded properties will be charged a connection fee at the time of development or connection to city utilities, the exclusion policy (having a functional on-site system) for homesteaded parcels will not apply. In addition to the street and trail assessments proposed in this report, each benefitted property is subject to trunk utility assessments. Based on the City’s Special Assessment Policy, it is proposed to levy trunk assessments in the year subdivision/development approvals are granted to a property or the determination of lateral benefit. For this project, the determination of lateral benefit will be at the time of connection. Homesteaded parcels will be subject to a trunk utility (sewer and water) assessment of $520 for the first half acre, with the balance of the developable acreage subject to the prevailing acreage rate (2023 rate = $9,526.00 per acre) at the time of development or connection. Utility connection fees, for sanitary sewer and water, will be charged at the prevailing rate at the time of development or connection based on the actual developed, subdivided or connected units. This report proposes to apportion assessable project costs to identified benefitting properties on a unit or lot unit basis. Potential units have been estimated for each of the benefitting properties that are currently un-developed or under-developed based on a review of the properties and their development potential, as well as taking into account existing topography and Metropolitan Urban Service Area (MUSA) boundaries.
Page 9 VI. CONCLUSIONS AND RECOMMENDATIONS Based on this study, Improvement Contract No. 17-5990 is feasible, cost effective, necessary, and the resulting benefit will equal or exceed the proposed assessments to the abutting and benefitting properties. It
is therefore recommended that the Eden Prairie City Council proceed with the project on a schedule similar to the one suggested in this report.
Page 10 CITY OF EDEN PRAIRIE NOTICE OF HEARING ON PROPOSED
PUBLIC WORKS IMPROVEMENTS I.C. 17-5990 _________________________________________________________________ TO WHOM IT MAY CONCERN: NOTICE IS HEREBY GIVEN that the Eden Prairie City Council will meet at the City Center, 8080 Mitchell Road, at 7:00 p.m. January 16th to consider the making of the following described improvements: I.C. 17-5990 – Street, Storm Drainage, Sanitary Sewer and Watermain improvements on Dell Road. The project includes grading, pavement, curb and gutter, retaining walls, storm sewer, sanitary sewer, lift station, forcemain, watermain, and trail. The area proposed to be assessed lies in Section 29 and 30, Township 116, Range 22. The total estimated project cost is $8,392,600. Pursuant to Minnesota State Laws, Section 429.011 to 429.111, the area proposed to be assessed for such improvements is all that property within or abutting on the above described limits. Written or oral comments relating to the proposed improvements will be received at this meeting. By Order of the City Council City Clerk City of Eden Prairie 8080 Mitchell Road Eden Prairie, MN 55344 Publish: Eden Prairie Sun Sailor January 4 and January 11, 2024
Page 11 PROJECT SCHEDULE (I.C. 17-5990) November 14, 2023 City Council to Receive Feasibility Report December 28, 2023 Deliver Notice of Public Hearing to Eden Prairie Sun Current Publish January 4 and January 11, 2023 January 4, 2024 Mail Notice of Public Hearing to Public January 16, 2024 Hold Public Hearing, Order Improvements and Preparation of Plans and Specifications City Received Private Culvert Petition February 2024 Approve Final Design Agreement with City Consultant Private Culvert Petition Received by Council – Resolution Adopted May 7, 2024 Order Private Culvert Improvements along with the Dell Road Improvements September 17, 2024 Approve Plans and Specifications and Order Advertisement of Bids Advertise for Bids in Eden Prairie Sun Current and online QuestCDN on October 10 (estimated) October 31, 2024 Open Bids (estimated) November 12, 2024 Award Contract (estimated) November 2025 Substantial Completion July 2026 Final Completion October 2026 Final Assessment Hearing Spring 2027 Assessments First Appear on Tax Statements
Page 12 TABLE NO. 1 ESTIMATED COSTS EDEN PRAIRIE IMPROVEMENT CONTRACT NO. 17-5990 DELL ROAD IMPROVEMENTS STREET and UTILITIES Street Storm Drainage Sewer and Water Total Total Project Cost1 $5,600,000 $1,067,600 $1,725,000 $8,392,600 Total City Cost $4,396,900 $1,067,600 $1,725,000 $7,189,500 (86%) Project Assessment Cost2 $1,203,100 NA NA 1,203,100 (14%) Private Culvert Costs1,2 $188,300 $188,300 1 Includes construction, 10% construction contingency, and 25% for engineering and testing 2 Includes additional 10% beyond the project costs for financing and administration
PARCEL P.I.D. NO. ADDRESSOWNERHMSTD GROSS FOOT POTENTIALESTIMATEDNO.NOTESUNITS AMOUNT UNITS AMOUNT1 30-116-22-41-0002 9905 Dell Rd Mable Marshall Revocable TrustY 30.53 552 52 $847,600.00$847,600.002 29-116-22-32-0005 9991 Dell Rd Sasan MokhtariY 3.63 522 $32,600.00$32,600.003 30-116-22-44-0011 10020 Dell Rd Shannon Joint Revocable TrustY 10.66 533 $48,900.00$48,900.004 30-116-22-44-0013 9989 Dell Rd Bahman RazmpourN 1.46 5. 7. 11 $9,800.00$9,800.005 30-116-22-44-0014 9993 Dell Rd Ajay GeorgeN 1.33 5. 7. 11 $9,800.00$9,800.006 29-116-22-33-0016 9995 Dell Rd Robert StandalY 1.11 511 $16,300.00$16,300.007 29-116-22-33-0017 9997 Dell Rd Husam KamshehY 1.20 511 $16,300.00$16,300.008 29-116-22-33-0019 9998 Dell Rd Robert GrootwassinkN 1.45 522 $32,600.00$32,600.009 29-116-22-33-0020 9999 Dell Rd Tim McLaughlinY 1.64 522 $32,600.00$32,600.0010 29-116-22-33-0014 10001 Dell Rd Charles DemersY 6.16 533 $48,900.00$48,900.0011 29-116-22-33-0009 10003 Dell Rd Robert WenglerN 7.08 533 $48,900.00$48,900.0012 30-116-22-41-0004 9980 Dell Rd Andrew J CostiganY 1.87 711 $4,900.00$4,900.0013 30-116-22-41-0005 NAMargaret DoyleY 2.34$0.0014 30-116-22-41-0003 NAMargaret DoyleY 0.57 711 $4,900.00$4,900.0015 30-116-22-44-0012 9924 Dell Rd Margaret DoyleY 6.69 711 $9,800.00 1 $37,660.00 $47,460.0016 30-116-22-43-0016 9942 Dell Rd L Timothy & Karen Anderson Living Trust Y 0.70 711 $9,800.00 1 $37,660.00 $47,460.0017 30-116-22-43-0015 9950 Dell Rd Steven E. BrownY 6.16 711 $9,800.00 1 $37,660.00 $47,460.0018 30-116-22-43-0014 9958 Dell Rd David LinY 1.24 711 $9,800.00 1 $37,660.00 $47,460.0019 30-116-22-43-0013 9966 Dell Rd Paul PihlY 1.75 711 $9,800.00 1 $37,660.00 $47,460.0078 78 $1,203,100.00 5 $188,300.00 $1,391,400.00PRELIMINARY ASSESSMENT ROLL - AMENDED APRIL 2024DELL ROADEDEN PRAIRIE, MINNESOTAI.C. 17-5990Y OR N4. Utility connection fees will be charged at the prevailing rate at the time of development or connection based on actual developed or connected units (units are estimated). 2023 connection fee is $24,227 per connection (60% for sanitary sewer and 40% for water).AC TOTAL ASSESSMENT (6. 4.)5. Subject to additional trunk assessments at the time of development or connection to utilities (at the prevailing rate).UNITS (1.)PRIVATE CULVERT(8.)8. Based on an assessment rate dividing private culvert total estimated costs ($188,300) by 5 affected parcels or $37660 per unit.STREET (2. 3.)6. Excludes future connection fees and trunk assessments.TOTALSNote: Homesteaded properties will be subject to a trunk sewer and water assessment of $520 for the first half acre with the balance of the parcel's developable acreage (if applicable) subject to the prevailing acreage rate for trunk assessments at the time of development or connection. Any homesteaded parcel that has development potential will be assessed the equivalent of one full unit of assessment with the balance of the assessment deferred with interest until the time of development. Assessments for non-homesteaded and vacant parcels will be deferred with interest until the time of development or connection.7. Dell Road Improvements assessed as part of previous development agreement.1. With the existing topography, potential units are based on a general determination of potential developable or buildable areas taking into account steep slopes and subdivision potential.2. Based on an assessment rate of $16,300 per unit for an equivalent 28' wide street and 8' trail.3. Based on an assessment rate of $9,800 per unit for Dell Road improvements as part of the Meadowcroft and Doyle Addition Development Agreements.G:\Public Works\Engineering\IC#S\1-ACTIVE Folders\5990-17 Dell Road - Crestwood Ter to CSAH 61\05 Docs\Feasibility Study\Amended Feas Study Private culvert\Amended Preliminary Assessment Roll Dell Rd 04-2024
LEGEND
ASSESSMENT BOUNDARY
ROAD IMPROVEMENTS
TRAIL IMPROVEMENTS
DELL ROAD
FLYING CLOUD DRIVE
CRESTWOOD TERRACE
OVERLAN
D
T
R
L
TURNBULL ROAD
G:\Engineering\IC#s\1-ACTIVE Folders\5990-17 Dell Road - Crestwood Ter to CSAH 61\06 Design\CAD\Assessment\xSite.dwgCity of Eden Prairie
Dell Road ImprovementsDATE: 11/6/2023 IC# 17-5990
Improvement Area / Assessment Boundary FIG-1
NORTH
ROAD IMPROVEMENTS
TRAIL IMPROVEMENTS
LEGEND
BENEFITING PROPERTIES, 28-FOOTEQUIVALENT STREET AND TRAILASSESSMENT RATE @ $16,300/UNIT
ASSESSABLE STREET AND TRAILIMPROVEMENTS
CULVERT REPLACEMENT AREA NOTINCLUDED IN ASSESSMENT
PREVIOUSLY ASSESSED PROPERTYTHROUGH DEVELOPMENT AGREEMENT
FLYING CLOUD DRIVE
CRESTWOOD TERRACE
OVERLAND
T
R
L
TURNBULL ROAD
DELL ROAD
G:\Engineering\IC#s\1-ACTIVE Folders\5990-17 Dell Road - Crestwood Ter to CSAH 61\06 Design\CAD\Assessment\Figure 2 Street and Trail Improvements.dwgCity of Eden Prairie
Dell Road ImprovementsDATE: 11/6/2023 IC# 17-5990
Street And Trail Improvements FIG-2
NORTH
LEGEND
IMPROVEMENT AREA
PROPOSED STORM STRUCTURE
PROPOSED STORM SEWER MAIN
DELL ROAD
FLYING CLOUD DRIVE
CRESTWOOD TERRACE
OVERLAND
T
R
L
CULVERT REPLACEMENT
CONNECT TO EXISTING
PRIVATE STORM CULVERT POTENTIAL STORM POND
TURNBULL ROAD
G:\Engineering\IC#s\1-ACTIVE Folders\5990-17 Dell Road - Crestwood Ter to CSAH 61\06 Design\CAD\Assessment\Figure 3 Storm Drainage Improvements.dwgCity of Eden Prairie
Dell Road ImprovementsDATE: 11/1/2023 IC# 17-5990
Storm Drainage Improvements FIG-3
NORTH
LEGEND
IMPROVEMENT AREA
PROPOSED SANITARY STRUCTURE
PROPOSED WATER STRUCTURE
PROPOSED 8" SANITARY SEWER
PROPOSED 12" WATER MAIN
DELL ROADFLYING CLOUD DRIVE
CRESTWOOD TERRACE
OVERLAND
T
R
L
CONNECT TO EXISTING
TURNBULL ROAD
EXISTING WATER MAIN
LIFT STATION
G:\Engineering\IC#s\1-ACTIVE Folders\5990-17 Dell Road - Crestwood Ter to CSAH 61\06 Design\CAD\Assessment\Figure 4 Sanitary Sewer Water Main Improvements.dwgCity of Eden Prairie
Dell Road ImprovementsDATE: 11/1/2023 IC# 17-5990
Sanitary Sewer & Water Main Improvements FIG-4
NORTH
CITY OF EDEN PRAIRIE HENNEPIN COUNTY, MINNESOTA RESOLUTION NO. 2024-__ RESOLUTION ORDERING PETITIONED IMPROVEMENTS AND INCLUDING WITH THE PREPARATION OF PLANS AND SPECIFICATIONS FOR THE DELL ROAD IMPROVEMENTS WHEREAS, a resolution of the City Council adopted the 16th day of January, 2024 ordered the Dell Road Street and Utility Improvements I.C. No. 17-5990 (Dell Road Improvements), and WHEREAS, a valid petition was received by City Council on February 6, 2024 requesting the City to incorporate private culvert repair work into the Dell Road Improvements, and WHEREAS, City Council adopted a resolution to amend the Dell Road Improvements feasibility report to incorporate the private culvert repair work and bring that amended report back to Council for approval. NOW, THEREFORE, BE IT RESOLVED BY THE EDEN PRAIRIE CITY COUNCIL: 1. Such improvements are necessary, cost-effective, and feasible as detailed in the amended feasibility report. 2. Such improvements are hereby ordered to be incorporated into the Dell Road Improvements Plans and Specifications. 3. The City Engineer is hereby designated as the Engineer for this improvement, I.C. 17-5990. They shall prepare plans and specifications, with assistance from WSB, for the making of such improvements. ADOPTED by the Eden Prairie City Council on May 7, 2024. ________________________ Ronald Case, Mayor ATTEST: SEAL ________________________ David Teigland, Clerk
CITY COUNCIL AGENDA
SECTION: Consent Calendar
DATE:
May 7, 2024
DEPARTMENT/DIVISION:
Carter Schulze
Public Works / Engineering
ITEM DESCRIPTION: #19810
Approve Professional Services Agreement with SRF Consulting Group for Construction Administration Services for the West 70th Street East
Segment Improvement Project
ITEM NO.:
VIII.I.
Requested Action Move to: Approve Professional Services Agreement with SRF Consulting Group, Inc. for Construction Administration Services for the West 70th Street East Segment
Improvement Project. Synopsis This Professional Services Agreement will provide construction administration services for the
eastern portion of West 70th Street between the recently constructed Golden Triangle LRT
Station and Shady Oak Road. Background Information
The West 70th Street Improvement project includes two segments that have been individually
identified in the Capital Improvement Plan and which will result in a continuous West 70th Street roadway connection between Flying Cloud Drive and Shady Oak Road. The west segment, completed in 2015, was the extension of West 70th Street from its previous terminus westerly to Flying Cloud Drive. The east segment includes the reconstruction of the existing West 70th Street
roadway to match the design of the west extension.
The two segments of West 70th Street are divided by the Southwest LRT alignment, which crosses West 70th and the Golden Triangle LRT Station. It is anticipated that the construction of the east segment will be substantially complete by October 2024.
Financial Implications The Professional Services Agreement with SRF has an estimated cost of $110,640.00. Funding for the project includes the Capital Maintenance and Reinvestment fund, Utility funds and the
Economic Development Fund.
Attachment Professional Services Agreement
2024 03 08
Version 2024 03 08 Agreement for Professional Services Th is Agreement (“Agreement”) is made on the 7th_ day of May, 2024, between the City of Eden
Prairie, Minnesota (hereinafter “City”), whose business address is 8080 Mitchell Road, Eden
Prairie, MN 55344, and SRF Consulting Group, Inc. (“Consultant”), a Minnesota Corporation
(hereinafter “Consultant”) whose business address is 3701 West Wayzata Boulevard, Suite 100,
Minneapolis, MN 55416. Preliminary Statement The City has adopted a policy regarding the selection and hiring of consultants to provide a variety
of professional services for City projects. That policy requires that persons, firms or corporations
providing such services enter into written agreements with the City. The purpose of this Agreement is to set forth the terms and conditions for the provision of professional services by Consultant for W 70th Street East Segment Improvements hereinafter referred to as the “Work”. The City and Consultant agree as follows: 1. Scope of Work. The Consultant agrees to provide the professional services shown in
Exhibit A ( SRF Letter Dated April 11, 2024 ) in connection with the Work. Exhibit A is
intended to be the scope of service for the work of the Consultant. Any general or specific
conditions, terms, agreements, consultant or industry proposal, or contract terms attached
to or a part of Exhibit A are declined in full and, accordingly, are deleted and shall not be
in effect in any manner. 2. Term. The term of this Agreement shall be from _May 7, 2024 through June 15, 2025 the
date of signature by the parties notwithstanding. This Agreement may be extended upon the written mutual consent of the parties for such additional period as they deem appropriate, and upon the terms and conditions as herein stated. 3. Compensation for Services. City agrees to pay the Consultant on an hourly basis plus expenses in a total amount not to exceed $ 110,640.00 for the services as described in
Exhibit A.
a. Any changes in the scope of the work which may result in an increase to the compensation due the Consultant shall require prior written approval by an authorized representative of the City or by the City Council. The City will not pay
additional compensation for services that do not have prior written authorization. b. Special Consultants may be utilized by the Consultant when required by the
complex or specialized nature of the Project and when authorized in writing by the City. c. If Consultant is delayed in performance due to any cause beyond its reasonable
control, including but not limited to strikes, riots, fires, acts of God, governmental
actions, actions of a third party, or actions or inactions of City, the time for
SRF W 70th East Segment Page 2 of 10 2024 03 08 performance shall be extended by a period of time lost by reason of the delay. Consultant will be entitled to payment for its reasonable additional charges, if any,
due to the delay. 4. City Information. The City agrees to provide the Consultant with the complete
information concerning the Scope of the Work and to perform the following services:
a. Access to the Area. Depending on the nature of the Work, Consultant may from
time to time require access to public and private lands or property. As may be
necessary, the City shall obtain access to and make all provisions for the Consultant
to enter upon public and private lands or property as required for the Consultant to
perform such services necessary to complete the Work. b. Consideration of the Consultant's Work. The City shall give thorough
consideration to all reports, sketches, estimates, drawings, and other documents
presented by the Consultant, and shall inform the Consultant of all decisions required of City within a reasonable time so as not to delay the work of the Consultant. c. Standards. The City shall furnish the Consultant with a copy of any standard or
criteria, including but not limited to, design and construction standards that may be
required in the preparation of the Work for the Project. d. City's Representative. A person shall be appointed to act as the City's representative
with respect to the work to be performed under this Agreement. He or she shall
have complete authority to transmit instructions, receive information, interpret, and
define the City's policy and decisions with respect to the services provided or
materials, equipment, elements and systems pertinent to the work covered by this Agreement. 5. Method of Payment. The Consultant shall submit to the City, on a monthly basis, an
itemized invoice for professional services performed under this Agreement. Invoices
submitted shall be paid in the same manner as other claims made to the City for:
a. Progress Payment. For work reimbursed on an hourly basis, the Consultant shall
indicate for each employee, his or her name, job title, the number of hours worked,
rate of pay for each employee, a computation of amounts due for each employee,
and the total amount due for each project task. Consultant shall verify all statements
submitted for payment in compliance with Minnesota Statutes Sections 471.38 and
471.391. For reimbursable expenses, if provided for in Exhibit A, the Consultant shall provide an itemized listing and such documentation as reasonably required by the City. Each invoice shall contain the City’s project number and a progress
summary showing the original (or amended) amount of the contract, current billing,
past payments and unexpended balance of the contract. b. Suspended Work. If any work performed by the Consultant is suspended in whole
or in part by the City, the Consultant shall be paid for any services set forth on
SRF W 70th East Segment Page 3 of 10 2024 03 08 Exhibit A performed prior to receipt of written notice from the City of such suspension. c. Payments for Special Consultants. The Consultant shall be reimbursed for the work
of special consultants, as described herein, and for other items when authorized in
writing by the City. d. Claims. By making the claim for payment, the person making the claim is declaring
that the account, claim, or demand is just and correct and that no part of it has been
paid. 6. Project Manager and Staffing. The Consultant shall designate a Project Manager and
notify the City in writing of the identity of the Project Manager before starting work on the
Project. The Project Manager shall be assisted by other staff members as necessary to
facilitate the completion of the Work in accordance with the terms established herein.
Consultant may not remove or replace the Project Manager without the approval of the City. 7. Standard of Care. Consultant shall exercise the same degree of care, skill and diligence in the performance of its services as is ordinarily exercised by members of the profession under similar circumstances in Hennepin County, Minnesota. Consultant shall be liable to
the fullest extent permitted under applicable law, without limitation, for any injuries, loss,
or damages proximately caused by Consultant's breach of this standard of care. Consultant
shall put forth reasonable efforts to complete its duties in a timely manner. Consultant shall not be responsible for delays caused by factors beyond its control or that could not be reasonably foreseen at the time of execution of this Agreement. Consultant shall be
responsible for costs, delays or damages arising from unreasonable delays in the
performance of its duties.
8. Termination. This Agreement may be terminated by either party by seven (7) days written
notice delivered to the other party at the address written above. Upon termination under
this provision, if there is no fault of the Consultant, the Consultant shall be paid for services
rendered and reimbursable expenses until the effective date of termination. If however, the City terminates the Agreement because the Consultant has failed to perform in accordance with this Agreement, no further payment shall be made to the Consultant, and the City may
retain another consultant to undertake or complete the Work identified herein. 9. Subcontractor. The Consultant shall not enter into subcontracts for services provided
under this Agreement except as noted in the Scope of Work, without the express written
consent of the City. The Consultant shall pay any subcontractor involved in the
performance of this Agreement within ten (10) days of the Consultant's receipt of payment
by the City for undisputed services provided by the subcontractor. If the Consultant fails
within that time to pay the subcontractor any undisputed amount for which the Consultant
has received payment by the City, the Consultant shall pay interest to the subcontractor on
the unpaid amount at the rate of 1.5 percent per month or any part of a month. The
minimum monthly interest penalty payment for an unpaid balance of $100 or more is $10.
SRF W 70th East Segment Page 4 of 10 2024 03 08 For an unpaid balance of less than $100, the Consultant shall pay the actual interest penalty due to the subcontractor. A subcontractor who prevails in a civil action to collect interest
penalties from the Consultant shall be awarded its costs and disbursements, including
attorney's fees, incurred in bringing the action. 10. Independent Consultant. Consultant is an independent contractor engaged by City to perform the services described herein and as such (i) shall employ such persons as it shall deem necessary and appropriate for the performance of its obligations pursuant to this
Agreement, who shall be employees, and under the direction, of Consultant and in no
respect employees of City, and (ii) shall have no authority to employ persons, or make
purchases of equipment on behalf of City, or otherwise bind or obligate City. No statement
herein shall be construed so as to find the Consultant an employee of the City. 11. Insurance. a. General Liability. Prior to starting the Work, Consultant shall procure, maintain and pay for such insurance as will protect against claims or loss which may arise out of operations by Consultant or by any subcontractor or by anyone employed by any of
them or by anyone for whose acts any of them may be liable. Such insurance shall
include, but not be limited to, minimum coverages and limits of liability specified in
this Paragraph, or required by law. b. If Consultant’s insurance does not afford coverage on behalf of subcontractors,
Consultant must require and verify that all subcontractors maintain insurance meeting
all the requirements of this paragraph 11, and Consultant must include in its contract
with subcontractors the requirement that the City be listed as an additional insured on
insurance required from subcontractors. In such case, prior to a subcontractor
performing any Work covered by this Agreement, Consultant must: (i) provide the City
with a certificate of insurance issued by the subcontractor’s insurance agent indicating
that the City is an additional insured on the subcontractor’s insurance policy; and (ii)
submit to the City a copy of Consultant’s agreement with the subcontractor for purposes
of the City’s review of compliance with the requirements of this paragraph 11. c. Consultant shall procure and maintain the following minimum insurance coverages and limits of liability for the Work: Worker’s Compensation Statutory Limits Employer’s Liability $500,000 each accident $500,000 disease policy limit $500,000 disease each employee Commercial General $1,000,000 property damage and bodily
Liability injury per occurrence $2,000,000 general aggregate $2,000,000 Products – Completed Operations Aggregate
SRF W 70th East Segment Page 5 of 10 2024 03 08 $100,000 fire legal liability each occurrence $5,000 medical expense Comprehensive Automobile
Liability $1,000,000 combined single limit each accident
(shall include coverage for all owned, hired and
non-owed vehicles.) Umbrella or Excess Liability $1,000,000 d. Commercial General Liability. The Commercial General Liability Policy shall be on
ISO form CG 00 01 12 07 or CG 00 01 04 13, or the equivalent. Such insurance shall
cover liability arising from premises, operations, independent contractors, products-
completed operations, personal and advertising injury, and liability assumed under an
insured contract (including the tort liability of another assumed in a business contract).
There shall be no endorsement or modification of the Commercial General Liability
form arising from pollution, explosion, collapse, underground property damage or
work performed by subcontractors. e. Professional Liability Insurance. In addition to the coverages listed above, Consultant
shall maintain a professional liability insurance policy in the amount of $2,000,000.
Said policy need not name the City as an additional insured. It shall be Consultant’s
responsibility to pay any retention or deductible for the professional liability insurance. Consultant agrees to maintain the professional liability insurance for a minimum of two (2) years following termination of this Agreement. f. Consultant shall maintain “stop gap” coverage if Consultant obtains Workers’ Compensation coverage from any state fund if Employer’s liability coverage is not available. g. All policies, except the Worker’s Compensation Policy, Automobile Policy, and
Professional Liability Policy, shall name the “City of Eden Prairie” as an additional
insured including products and completed operations. h. All policies, except the Professional Liability Policy, shall apply on a “per project”
basis. i. All General Liability policies, Automobile Liability policies and Umbrella policies
shall contain a waiver of subrogation in favor of the City. j. All policies, except for the Worker’s Compensation Policy and the Professional
Liability Policy, shall be primary and non-contributory. k. All polices, except the Worker’s Compensation Policy, shall insure the defense and
indemnity obligations assumed by Consultant under this Agreement. The Professional
Liability policy shall insure the defense and indemnity obligations assumed by
SRF W 70th East Segment Page 6 of 10 2024 03 08 Consultant under this Agreement except with respect to the liability for loss or damage resulting from the negligence or fault of anyone other than the Consultant or others for
whom the Consultant is legally liable. l. Consultant agrees to maintain all coverage required herein throughout the term of the Agreement and for a minimum of two (2) years following City’s written acceptance of
the Work. m. It shall be Consultant’s responsibility to pay any retention or deductible for the coverages required herein. n. All policies shall contain a provision or endorsement that coverages afforded thereunder shall not be cancelled or non-renewed or restrictive modifications added,
without thirty (30) days’ prior notice to the City, except that if the cancellation or non-
renewal is due to non-payment, the coverages may not be terminated or non-renewed
without ten (10) days’ prior notice to the City. o. Consultant shall maintain in effect all insurance coverages required under this Paragraph at Consultant’s sole expense and with insurance companies licensed to do
business in the state in Minnesota and having a current A.M. Best rating of no less than
A-, unless specifically accepted by City in writing. p. A copy of the Consultant’s Certificate of Insurance which evidences the compliance with this Paragraph, must be filed with City prior to the start of
Consultant’s Work. Upon request a copy of the Consultant’s insurance declaration
page, Rider and/or Endorsement, as applicable shall be provided. Such documents evidencing Insurance shall be in a form acceptable to City and shall provide satisfactory evidence that Consultant has complied with all insurance requirements. Renewal certificates shall be provided to City prior to the expiration date of any of the required
policies. City will not be obligated, however, to review such Certificate of Insurance,
declaration page, Rider, Endorsement or certificates or other evidence of insurance, or to advise Consultant of any deficiencies in such documents and receipt thereof shall not relieve Consultant from, nor be deemed a waiver of, City’s right to enforce the
terms of Consultant’s obligations hereunder. City reserves the right to examine any
policy provided for under this paragraph. q. Effect of Consultant’s Failure to Provide Insurance. If Consultant fails to provide the specified insurance, then Consultant will defend, indemnify and hold harmless the City, the City's officials, agents and employees from any loss, claim, liability and expense (including reasonable attorney's fees and expenses of litigation) to the extent necessary to afford the same protection as would have been provided by the specified insurance. Except to the extent prohibited by law, this indemnity applies regardless of any strict
liability or negligence attributable to the City (including sole negligence) and regardless
of the extent to which the underlying occurrence (i.e., the event giving rise to a claim which would have been covered by the specified insurance) is attributable to the negligent or otherwise wrongful act or omission (including breach of contract) of
SRF W 70th East Segment Page 7 of 10 2024 03 08 Consultant, its subcontractors, agents, employees or delegates. Consultant agrees that this indemnity shall be construed and applied in favor of indemnification. Consultant also agrees that if applicable law limits or precludes any aspect of this indemnity, then the indemnity will be considered limited only to the extent necessary to comply with that applicable law. The stated indemnity continues until all applicable statutes of limitation
have run. If a claim arises within the scope of the stated indemnity, the City may require Consultant to: i. Furnish and pay for a surety bond, satisfactory to the City, guaranteeing performance of the indemnity obligation; or ii. Furnish a written acceptance of tender of defense and indemnity from Consultant's insurance company. Consultant will take the action required by the City within fifteen (15) days of receiving
notice from the City. 12. Indemnification. Consultant will defend and indemnify City, its officers, agents, and
employees and hold them harmless from and against all judgments, claims, damages, costs
and expenses, including a reasonable amount as and for its attorney’s fees paid, incurred
or for which it may be liable resulting from any breach of this Agreement by Consultant,
its agents, contractors and employees, or any negligent or intentional act or omission
performed, taken or not performed or taken by Consultant, its agents, contractors and
employees, relative to this Agreement. City will indemnify and hold Consultant harmless
from and against any loss for injuries or damages arising out of the negligent acts of the
City, its officers, agents or employees. 13. Ownership of Documents. All plans, diagrams, analyses, reports and information generated in connection with the performance of the Agreement (“Information”) shall become the property of the City, but Consultant may retain copies of such documents as
records of the services provided. The City may use the Information for its purposes and the
Consultant also may use the Information for its purposes. Use of the Information for the
purposes of the project contemplated by this Agreement (“Project”) does not relieve any
liability on the part of the Consultant, but any use of the Information by the City or the
Consultant beyond the scope of the Project is without liability to the other, and the party using the Information agrees to defend and indemnify the other from any claims or liability resulting therefrom. 14. Mediation. Each dispute, claim or controversy arising from or related to this agreement
shall be subject to mediation as a condition precedent to initiating arbitration or legal or
equitable actions by either party. Unless the parties agree otherwise, the mediation shall be in accordance with the Commercial Mediation Procedures of the American Arbitration Association then currently in effect. A request for mediation shall be filed in writing with
the American Arbitration Association and the other party. No arbitration or legal or
equitable action may be instituted for a period of 90 days from the filing of the request for
mediation unless a longer period of time is provided by agreement of the parties. Cost of
SRF W 70th East Segment Page 8 of 10 2024 03 08 mediation shall be shared equally between the parties. Mediation shall be held in the City of Eden Prairie unless another location is mutually agreed upon by the parties. The parties shall memorialize any agreement resulting from the mediation in a mediated settlement agreement, which agreement shall be enforceable as a settlement in any court having
jurisdiction thereof. GENERAL TERMS AND CONDITIONS 15. Assignment. Neither party shall assign this Agreement, nor any interest arising herein,
without the written consent of the other party. 16. Compliance with Laws and Regulations. In providing services hereunder, the
Consultant shall abide by statutes, ordinances, rules, and regulations pertaining to the
provisions of services to be provided. Any violation of statutes, ordinances, rules and regulations pertaining to the services to be provided shall constitute a material breach of this Agreement and entitle the City to immediately terminate this Agreement. 17. Conflicts. No salaried officer or employee of the City and no member of the Council of
the City shall have a financial interest, direct or indirect, in this Agreement. The violation
of this provision renders the Agreement void. 18. Counterparts. This Agreement may be executed in multiple counterparts, each of which
shall be considered an original. 19. Damages. In the event of a breach of this Agreement by the City, Contractor shall not be
entitled to recover punitive, special or consequential damages or damages for loss of
business. 20. Employees. Contractor agrees not to hire any employee or former employee of City and City agrees not to hire any employee or former employee of Contractor prior to termination of this Agreement and for one (1) year thereafter, without prior written consent of the
former employer in each case. 21. Enforcement. The Contractor shall reimburse the City for all costs and expenses,
including without limitation, attorneys' fees paid or incurred by the City in connection with the enforcement by the City during the term of this Agreement or thereafter of any of the rights or remedies of the City under this Agreement. 22. Entire Agreement, Construction, Application and Interpretation. This Agreement is
in furtherance of the City’s public purpose mission and shall be construed, interpreted, and
applied pursuant to and in conformance with the City's public purpose mission. The entire
agreement of the parties is contained herein. This Contract supersedes all oral agreements
and negotiations between the parties relating to the subject matter hereof as well as any
previous agreements presently in effect between the parties relating to the subject matter
hereof. Any alterations, amendments, deletions, or waivers of the provisions of this
SRF W 70th East Segment Page 9 of 10 2024 03 08 Contract shall be valid only when expressed in writing and duly signed by the parties, unless otherwise provided herein. 23. Governing Law. This Agreement shall be controlled by the laws of the State of
Minnesota. 24. Non-Discrimination. During the performance of this Agreement, the Consultant shall not
discriminate against any employee or applicants for employment because of race, color,
creed, religion, national origin, sex, marital status, status with regard to public assistance,
disability, sexual orientation or age. The Consultant shall post in places available to
employees and applicants for employment, notices setting forth the provision of this non-discrimination clause and stating that all qualified applicants will receive consideration for employment. The Consultant shall incorporate the foregoing requirements of this
paragraph in all of its subcontracts for program work, and will require all of its
subcontractors for such work to incorporate such requirements in all subcontracts for
program work. The Consultant further agrees to comply with all aspects of the Minnesota
Human Rights Act, Minnesota Statutes 363.01, et. seq., Title VI of the Civil Rights Act of
1964, and the Americans with Disabilities Act of 1990. 25. Notice. Any notice required or permitted to be given by a party upon the other is given in accordance with this Agreement if it is directed to either party by delivering it personally to an officer of the party, or if mailed in a sealed wrapper by United States registered or
certified mail, return receipt requested, postage prepaid, or if deposited cost paid with a
nationally recognized, reputable overnight courier, properly addressed to the address listed
on page 1 hereof. Notices shall be deemed effective on the earlier of the date of receipt or
the date of mailing or deposit as aforesaid, provided, however, that if notice is given by
mail or deposit, that the time for response to any notice by the other party shall commence
to run one business day after any such mailing or deposit. A party may change its address
for the service of notice by giving written notice of such change to the other party, in any
manner above specified, 10 days prior to the effective date of such change. 26. Rights and Remedies. The duties and obligations imposed by this Agreement and the
rights and remedies available thereunder shall be in addition to and not a limitation of any
duties, obligations, rights and remedies otherwise imposed or available by law. 27. Services Not Provided For. No claim for services furnished by the Consultant not
specifically provided for herein shall be honored by the City. 28. Severability. The provisions of this Agreement are severable. If any portion hereof is, for
any reason, held by a court of competent jurisdiction to be contrary to law, such decision
shall not affect the remaining provisions of this Agreement. 29. Statutory Provisions. a. Audit Disclosure. The books, records, documents and accounting procedures and
practices of the Consultant or other parties relevant to this Agreement are subject to
SRF W 70th East Segment Page 10 of 10 2024 03 08 examination by the City and either the Legislative Auditor or the State Auditor for a period of six (6) years after the effective date of this Agreement. b. Data Practices. Any reports, information, or data in any form given to, or prepared or assembled by the Consultant under this Agreement which the City requests to be kept confidential, shall not be made available to any individual or organization without the
City's prior written approval. This Agreement is subject to the Minnesota Government Data
Practice Act, Minnesota Statutes Chapter 13 (Data Practices Act). All government data, as
defined in the Data Practices Act Section 13.02, Subd 7, which is created, collected,
received, stored, used, maintained, or disseminated by Consultant in performing any of the
functions of the City during performance of this Agreement is subject to the requirements
of the Data Practice Act and Consultant shall comply with those requirements as if it were
a government entity. All subcontracts entered into by Consultant in relation to this
Agreement shall contain similar Data Practices Act compliance language. 30. Waiver. Any waiver by either party of a breach of any provisions of this Agreement shall
not affect, in any respect, the validity of the remainder of this Agreement. Executed as of the day and year first written above. CITY OF EDEN PRAIRIE __________________________ ___ _____ Mayor ______________________________ _____ City Manager CONSULTANT By: Its:
CITY COUNCIL AGENDA
SECTION: Consent Calendar
DATE:
May 7, 2024
DEPARTMENT/DIVISION:
Adam Gadbois
Public Works / Engineering
ITEM DESCRIPTION: #19810
Approve Professional Services Agreement with SRF Consulting Group for Construction Administration Services for the Prairie Center Drive
Pavement Rehabilitation Project
ITEM NO.:
VIII.J.
Requested Action
Move to: Approve Professional Services Agreement with SRF Consulting Group, Inc. for Construction Administration Services for the Prairie Center Drive Pavement Rehabilitation Project.
Synopsis This Professional Services Agreement will provide construction administration services for the pavement rehabilitation of Prairie Center Drive from TH 212 to Flying Cloud Drive.
Background Information The Prairie Center Drive Pavement Rehabilitation project involves complete removal of the existing asphalt pavement along the project corridor and replacement with a stabilized base
material and new asphalt section. The scope also includes improvements to the existing traffic
signal at Regional Center Drive/Columbine Road/Prairie Center Drive which include flashing yellow arrow conversion and reconstructing the pedestrian facilities to meet current Americans with Disabilities Act requirements. Construction will be phased along the corridor and will result in directional closures and detours for the travelling public. It is anticipated that construction will
begin in mid-to-late June and be substantially complete by September 2024.
Financial Implications The Professional Services Agreement with SRF has an estimated cost of $105,104.50. Funding
for the project includes the pavement management fund, the transportation fund, and the storm
water utility fund. Attachment
Professional Services Agreement
2024 03 08
Version 2024 03 08
Agreement for Professional Services
This Agreement (“Agreement”) is made on the 7th day of May, 2024, between the City of Eden Prairie, Minnesota (hereinafter “City”), whose business address is 8080 Mitchell Road, Eden Prairie, MN 55344, and SRF Consulting Group, Inc. (“Consultant”), a Minnesota Corporation (hereinafter “Consultant”) whose business address is 3701 West Wayzata Boulevard, Suite 100,
Minneapolis, MN 55416.
Preliminary Statement The City has adopted a policy regarding the selection and hiring of consultants to provide a variety
of professional services for City projects. That policy requires that persons, firms or corporations
providing such services enter into written agreements with the City. The purpose of this Agreement is to set forth the terms and conditions for the provision of professional services by Consultant for Prairie Center Drive Pavement Rehabilitation Project hereinafter referred to as the “Work”.
The City and Consultant agree as follows: 1. Scope of Work. The Consultant agrees to provide the professional services shown in Exhibit A (SRF Letter Dated April 17, 2024 ) in connection with the Work. Exhibit A is intended to be the scope of service for the work of the Consultant. Any general or specific
conditions, terms, agreements, consultant or industry proposal, or contract terms attached to or a PSA - SRF PCD Pavement Rehab Design part of Exhibit A are declined in full and, accordingly, are deleted and shall not be in effect in any manner. 2. Term. The term of this Agreement shall be from May 7, 2024 through June 15, 2025 the
date of signature by the parties notwithstanding. This Agreement may be extended upon the written mutual consent of the parties for such additional period as they deem appropriate, and upon the terms and conditions as herein stated. 3. Compensation for Services. City agrees to pay the Consultant on an hourly basis plus
expenses in a total amount not to exceed $105,104.50 for the services as described in Exhibit A. a. Any changes in the scope of the work which may result in an increase to the compensation due the Consultant shall require prior written approval by an authorized representative of the City or by the City Council. The City will not pay
additional compensation for services that do not have prior written authorization. b. Special Consultants may be utilized by the Consultant when required by the complex or specialized nature of the Project and when authorized in writing by the City.
c. If Consultant is delayed in performance due to any cause beyond its reasonable control, including but not limited to strikes, riots, fires, acts of God, governmental
SRF Prairie Center Drive Pavement Rehab Page 2 of 10 2024 03 08
actions, actions of a third party, or actions or inactions of City, the time for performance shall be extended by a period of time lost by reason of the delay.
Consultant will be entitled to payment for its reasonable additional charges, if any,
due to the delay. 4. City Information. The City agrees to provide the Consultant with the complete information concerning the Scope of the Work and to perform the following services:
a. Access to the Area. Depending on the nature of the Work, Consultant may from
time to time require access to public and private lands or property. As may be necessary, the City shall obtain access to and make all provisions for the Consultant to enter upon public and private lands or property as required for the Consultant to perform such services necessary to complete the Work.
b. Consideration of the Consultant's Work. The City shall give thorough consideration to all reports, sketches, estimates, drawings, and other documents presented by the Consultant, and shall inform the Consultant of all decisions required of City within a reasonable time so as not to delay the work of the Consultant.
c. Standards. The City shall furnish the Consultant with a copy of any standard or criteria, including but not limited to, design and construction standards that may be required in the preparation of the Work for the Project.
d. City's Representative. A person shall be appointed to act as the City's representative with respect to the work to be performed under this Agreement. He or she shall have complete authority to transmit instructions, receive information, interpret, and define the City's policy and decisions with respect to the services provided or materials, equipment, elements and systems pertinent to the work covered by this
Agreement. 5. Method of Payment. The Consultant shall submit to the City, on a monthly basis, an itemized invoice for professional services performed under this Agreement. Invoices submitted shall be paid in the same manner as other claims made to the City for:
a. Progress Payment. For work reimbursed on an hourly basis, the Consultant shall indicate for each employee, his or her name, job title, the number of hours worked, rate of pay for each employee, a computation of amounts due for each employee, and the total amount due for each project task. Consultant shall verify all statements submitted for payment in compliance with Minnesota Statutes Sections 471.38 and
471.391. For reimbursable expenses, if provided for in Exhibit A, the Consultant shall provide an itemized listing and such documentation as reasonably required by the City. Each invoice shall contain the City’s project number and a progress summary showing the original (or amended) amount of the contract, current billing, past payments and unexpended balance of the contract.
b. Suspended Work. If any work performed by the Consultant is suspended in whole or in part by the City, the Consultant shall be paid for any services set forth on
SRF Prairie Center Drive Pavement Rehab Page 3 of 10 2024 03 08
Exhibit A performed prior to receipt of written notice from the City of such suspension.
c. Payments for Special Consultants. The Consultant shall be reimbursed for the work of special consultants, as described herein, and for other items when authorized in writing by the City.
d. Claims. By making the claim for payment, the person making the claim is declaring
that the account, claim, or demand is just and correct and that no part of it has been paid. 6. Project Manager and Staffing. The Consultant shall designate a Project Manager and
notify the City in writing of the identity of the Project Manager before starting work on the
Project. The Project Manager shall be assisted by other staff members as necessary to facilitate the completion of the Work in accordance with the terms established herein. Consultant may not remove or replace the Project Manager without the approval of the City.
7. Standard of Care. Consultant shall exercise the same degree of care, skill and diligence in the performance of its services as is ordinarily exercised by members of the profession under similar circumstances in Hennepin County, Minnesota. Consultant shall be liable to the fullest extent permitted under applicable law, without limitation, for any injuries, loss, or damages proximately caused by Consultant's breach of this standard of care. Consultant
shall put forth reasonable efforts to complete its duties in a timely manner. Consultant shall not be responsible for delays caused by factors beyond its control or that could not be reasonably foreseen at the time of execution of this Agreement. Consultant shall be responsible for costs, delays or damages arising from unreasonable delays in the performance of its duties.
8. Termination. This Agreement may be terminated by either party by seven (7) days written notice delivered to the other party at the address written above. Upon termination under this provision, if there is no fault of the Consultant, the Consultant shall be paid for services rendered and reimbursable expenses until the effective date of termination. If however, the
City terminates the Agreement because the Consultant has failed to perform in accordance with this Agreement, no further payment shall be made to the Consultant, and the City may retain another consultant to undertake or complete the Work identified herein. 9. Subcontractor. The Consultant shall not enter into subcontracts for services provided
under this Agreement except as noted in the Scope of Work, without the express written consent of the City. The Consultant shall pay any subcontractor involved in the performance of this Agreement within ten (10) days of the Consultant's receipt of payment by the City for undisputed services provided by the subcontractor. If the Consultant fails within that time to pay the subcontractor any undisputed amount for which the Consultant
has received payment by the City, the Consultant shall pay interest to the subcontractor on the unpaid amount at the rate of 1.5 percent per month or any part of a month. The minimum monthly interest penalty payment for an unpaid balance of $100 or more is $10.
SRF Prairie Center Drive Pavement Rehab Page 4 of 10 2024 03 08
For an unpaid balance of less than $100, the Consultant shall pay the actual interest penalty due to the subcontractor. A subcontractor who prevails in a civil action to collect interest
penalties from the Consultant shall be awarded its costs and disbursements, including
attorney's fees, incurred in bringing the action. 10. Independent Consultant. Consultant is an independent contractor engaged by City to perform the services described herein and as such (i) shall employ such persons as it shall
deem necessary and appropriate for the performance of its obligations pursuant to this
Agreement, who shall be employees, and under the direction, of Consultant and in no respect employees of City, and (ii) shall have no authority to employ persons, or make purchases of equipment on behalf of City, or otherwise bind or obligate City. No statement herein shall be construed so as to find the Consultant an employee of the City.
11. Insurance. a. General Liability. Prior to starting the Work, Consultant shall procure, maintain and pay for such insurance as will protect against claims or loss which may arise out of operations by Consultant or by any subcontractor or by anyone employed by any of them or by anyone for whose acts any of them may be liable. Such insurance shall
include, but not be limited to, minimum coverages and limits of liability specified in this Paragraph, or required by law. b. If Consultant’s insurance does not afford coverage on behalf of subcontractors, Consultant must require and verify that all subcontractors maintain insurance meeting
all the requirements of this paragraph 11, and Consultant must include in its contract with subcontractors the requirement that the City be listed as an additional insured on insurance required from subcontractors. In such case, prior to a subcontractor performing any Work covered by this Agreement, Consultant must: (i) provide the City with a certificate of insurance issued by the subcontractor’s insurance agent indicating
that the City is an additional insured on the subcontractor’s insurance policy; and (ii) submit to the City a copy of Consultant’s agreement with the subcontractor for purposes of the City’s review of compliance with the requirements of this paragraph 11. c. Consultant shall procure and maintain the following minimum insurance coverages and
limits of liability for the Work: Worker’s Compensation Statutory Limits Employer’s Liability $500,000 each accident
$500,000 disease policy limit $500,000 disease each employee Commercial General $1,000,000 property damage and bodily Liability injury per occurrence
$2,000,000 general aggregate $2,000,000 Products – Completed Operations Aggregate
SRF Prairie Center Drive Pavement Rehab Page 5 of 10 2024 03 08
$100,000 fire legal liability each occurrence $5,000 medical expense
Comprehensive Automobile Liability $1,000,000 combined single limit each accident (shall include coverage for all owned, hired and non-owed vehicles.)
Umbrella or Excess Liability $1,000,000 d. Commercial General Liability. The Commercial General Liability Policy shall be on ISO form CG 00 01 12 07 or CG 00 01 04 13, or the equivalent. Such insurance shall
cover liability arising from premises, operations, independent contractors, products-
completed operations, personal and advertising injury, and liability assumed under an insured contract (including the tort liability of another assumed in a business contract). There shall be no endorsement or modification of the Commercial General Liability form arising from pollution, explosion, collapse, underground property damage or work performed by subcontractors.
e. Professional Liability Insurance. In addition to the coverages listed above, Consultant shall maintain a professional liability insurance policy in the amount of $2,000,000. Said policy need not name the City as an additional insured. It shall be Consultant’s responsibility to pay any retention or deductible for the professional liability insurance.
Consultant agrees to maintain the professional liability insurance for a minimum of two (2) years following termination of this Agreement. f. Consultant shall maintain “stop gap” coverage if Consultant obtains Workers’ Compensation coverage from any state fund if Employer’s liability coverage is not
available. g. All policies, except the Worker’s Compensation Policy, Automobile Policy, and Professional Liability Policy, shall name the “City of Eden Prairie” as an additional insured including products and completed operations.
h. All policies, except the Professional Liability Policy, shall apply on a “per project” basis. i. All General Liability policies, Automobile Liability policies and Umbrella policies
shall contain a waiver of subrogation in favor of the City. j. All policies, except for the Worker’s Compensation Policy and the Professional Liability Policy, shall be primary and non-contributory.
k. All polices, except the Worker’s Compensation Policy, shall insure the defense and indemnity obligations assumed by Consultant under this Agreement. The Professional Liability policy shall insure the defense and indemnity obligations assumed by
SRF Prairie Center Drive Pavement Rehab Page 6 of 10 2024 03 08
Consultant under this Agreement except with respect to the liability for loss or damage resulting from the negligence or fault of anyone other than the Consultant or others for
whom the Consultant is legally liable.
l. Consultant agrees to maintain all coverage required herein throughout the term of the Agreement and for a minimum of two (2) years following City’s written acceptance of the Work.
m. It shall be Consultant’s responsibility to pay any retention or deductible for the coverages required herein. n. All policies shall contain a provision or endorsement that coverages afforded
thereunder shall not be cancelled or non-renewed or restrictive modifications added,
without thirty (30) days’ prior notice to the City, except that if the cancellation or non-renewal is due to non-payment, the coverages may not be terminated or non-renewed without ten (10) days’ prior notice to the City. o. Consultant shall maintain in effect all insurance coverages required under this
Paragraph at Consultant’s sole expense and with insurance companies licensed to do business in the state in Minnesota and having a current A.M. Best rating of no less than A-, unless specifically accepted by City in writing. p. A copy of the Consultant’s Certificate of Insurance which evidences the compliance with this Paragraph, must be filed with City prior to the start of Consultant’s Work. Upon request a copy of the Consultant’s insurance declaration page, Rider and/or Endorsement, as applicable shall be provided. Such documents evidencing Insurance shall be in a form acceptable to City and shall provide satisfactory evidence that Consultant has complied with all insurance requirements. Renewal
certificates shall be provided to City prior to the expiration date of any of the required policies. City will not be obligated, however, to review such Certificate of Insurance, declaration page, Rider, Endorsement or certificates or other evidence of insurance, or to advise Consultant of any deficiencies in such documents and receipt thereof shall not relieve Consultant from, nor be deemed a waiver of, City’s right to enforce the
terms of Consultant’s obligations hereunder. City reserves the right to examine any policy provided for under this paragraph. q. Effect of Consultant’s Failure to Provide Insurance. If Consultant fails to provide the specified insurance, then Consultant will defend, indemnify and hold harmless the
City, the City's officials, agents and employees from any loss, claim, liability and expense (including reasonable attorney's fees and expenses of litigation) to the extent necessary to afford the same protection as would have been provided by the specified insurance. Except to the extent prohibited by law, this indemnity applies regardless of any strict liability or negligence attributable to the City (including sole negligence) and regardless
of the extent to which the underlying occurrence (i.e., the event giving rise to a claim which would have been covered by the specified insurance) is attributable to the negligent or otherwise wrongful act or omission (including breach of contract) of
SRF Prairie Center Drive Pavement Rehab Page 7 of 10 2024 03 08
Consultant, its subcontractors, agents, employees or delegates. Consultant agrees that this indemnity shall be construed and applied in favor of indemnification. Consultant
also agrees that if applicable law limits or precludes any aspect of this indemnity, then
the indemnity will be considered limited only to the extent necessary to comply with that applicable law. The stated indemnity continues until all applicable statutes of limitation have run.
If a claim arises within the scope of the stated indemnity, the City may require Consultant
to: i. Furnish and pay for a surety bond, satisfactory to the City, guaranteeing performance of the indemnity obligation; or ii. Furnish a written acceptance of tender of defense and indemnity from
Consultant's insurance company.
Consultant will take the action required by the City within fifteen (15) days of receiving notice from the City. 12. Indemnification. Consultant will defend and indemnify City, its officers, agents, and
employees and hold them harmless from and against all judgments, claims, damages, costs and expenses, including a reasonable amount as and for its attorney’s fees paid, incurred or for which it may be liable resulting from any breach of this Agreement by Consultant, its agents, contractors and employees, or any negligent or intentional act or omission performed, taken or not performed or taken by Consultant, its agents, contractors and
employees, relative to this Agreement. City will indemnify and hold Consultant harmless from and against any loss for injuries or damages arising out of the negligent acts of the City, its officers, agents or employees. 13. Ownership of Documents. All plans, diagrams, analyses, reports and information
generated in connection with the performance of the Agreement (“Information”) shall become the property of the City, but Consultant may retain copies of such documents as records of the services provided. The City may use the Information for its purposes and the Consultant also may use the Information for its purposes. Use of the Information for the purposes of the project contemplated by this Agreement (“Project”) does not relieve any
liability on the part of the Consultant, but any use of the Information by the City or the Consultant beyond the scope of the Project is without liability to the other, and the party using the Information agrees to defend and indemnify the other from any claims or liability resulting therefrom.
14. Mediation. Each dispute, claim or controversy arising from or related to this agreement shall be subject to mediation as a condition precedent to initiating arbitration or legal or equitable actions by either party. Unless the parties agree otherwise, the mediation shall be in accordance with the Commercial Mediation Procedures of the American Arbitration Association then currently in effect. A request for mediation shall be filed in writing with
the American Arbitration Association and the other party. No arbitration or legal or equitable action may be instituted for a period of 90 days from the filing of the request for mediation unless a longer period of time is provided by agreement of the parties. Cost of
SRF Prairie Center Drive Pavement Rehab Page 8 of 10 2024 03 08
mediation shall be shared equally between the parties. Mediation shall be held in the City of Eden Prairie unless another location is mutually agreed upon by the parties. The parties
shall memorialize any agreement resulting from the mediation in a mediated settlement
agreement, which agreement shall be enforceable as a settlement in any court having jurisdiction thereof.
GENERAL TERMS AND CONDITIONS
15. Assignment. Neither party shall assign this Agreement, nor any interest arising herein, without the written consent of the other party. 16. Compliance with Laws and Regulations. In providing services hereunder, the
Consultant shall abide by statutes, ordinances, rules, and regulations pertaining to the
provisions of services to be provided. Any violation of statutes, ordinances, rules and regulations pertaining to the services to be provided shall constitute a material breach of this Agreement and entitle the City to immediately terminate this Agreement. 17. Conflicts. No salaried officer or employee of the City and no member of the Council of
the City shall have a financial interest, direct or indirect, in this Agreement. The violation of this provision renders the Agreement void. 18. Counterparts. This Agreement may be executed in multiple counterparts, each of which shall be considered an original.
19. Damages. In the event of a breach of this Agreement by the City, Contractor shall not be entitled to recover punitive, special or consequential damages or damages for loss of business.
20. Employees. Contractor agrees not to hire any employee or former employee of City and City agrees not to hire any employee or former employee of Contractor prior to termination of this Agreement and for one (1) year thereafter, without prior written consent of the former employer in each case.
21. Enforcement. The Contractor shall reimburse the City for all costs and expenses, including without limitation, attorneys' fees paid or incurred by the City in connection with the enforcement by the City during the term of this Agreement or thereafter of any of the rights or remedies of the City under this Agreement.
22. Entire Agreement, Construction, Application and Interpretation. This Agreement is in furtherance of the City’s public purpose mission and shall be construed, interpreted, and applied pursuant to and in conformance with the City's public purpose mission. The entire agreement of the parties is contained herein. This Contract supersedes all oral agreements and negotiations between the parties relating to the subject matter hereof as well as any
previous agreements presently in effect between the parties relating to the subject matter hereof. Any alterations, amendments, deletions, or waivers of the provisions of this
SRF Prairie Center Drive Pavement Rehab Page 9 of 10 2024 03 08
Contract shall be valid only when expressed in writing and duly signed by the parties, unless otherwise provided herein.
23. Governing Law. This Agreement shall be controlled by the laws of the State of Minnesota. 24. Non-Discrimination. During the performance of this Agreement, the Consultant shall not
discriminate against any employee or applicants for employment because of race, color,
creed, religion, national origin, sex, marital status, status with regard to public assistance, disability, sexual orientation or age. The Consultant shall post in places available to employees and applicants for employment, notices setting forth the provision of this non-discrimination clause and stating that all qualified applicants will receive consideration for
employment. The Consultant shall incorporate the foregoing requirements of this
paragraph in all of its subcontracts for program work, and will require all of its subcontractors for such work to incorporate such requirements in all subcontracts for program work. The Consultant further agrees to comply with all aspects of the Minnesota Human Rights Act, Minnesota Statutes 363.01, et. seq., Title VI of the Civil Rights Act of 1964, and the Americans with Disabilities Act of 1990.
25. Notice. Any notice required or permitted to be given by a party upon the other is given in accordance with this Agreement if it is directed to either party by delivering it personally to an officer of the party, or if mailed in a sealed wrapper by United States registered or certified mail, return receipt requested, postage prepaid, or if deposited cost paid with a
nationally recognized, reputable overnight courier, properly addressed to the address listed on page 1 hereof. Notices shall be deemed effective on the earlier of the date of receipt or the date of mailing or deposit as aforesaid, provided, however, that if notice is given by mail or deposit, that the time for response to any notice by the other party shall commence to run one business day after any such mailing or deposit. A party may change its address
for the service of notice by giving written notice of such change to the other party, in any manner above specified, 10 days prior to the effective date of such change. 26. Rights and Remedies. The duties and obligations imposed by this Agreement and the rights and remedies available thereunder shall be in addition to and not a limitation of any
duties, obligations, rights and remedies otherwise imposed or available by law. 27. Services Not Provided For. No claim for services furnished by the Consultant not specifically provided for herein shall be honored by the City.
28. Severability. The provisions of this Agreement are severable. If any portion hereof is, for any reason, held by a court of competent jurisdiction to be contrary to law, such decision shall not affect the remaining provisions of this Agreement.
29. Statutory Provisions. a. Audit Disclosure. The books, records, documents and accounting procedures and practices of the Consultant or other parties relevant to this Agreement are subject to
SRF Prairie Center Drive Pavement Rehab Page 10 of 10 2024 03 08
examination by the City and either the Legislative Auditor or the State Auditor for a period of six (6) years after the effective date of this Agreement.
b. Data Practices. Any reports, information, or data in any form given to, or prepared or assembled by the Consultant under this Agreement which the City requests to be kept confidential, shall not be made available to any individual or organization without the City's prior written approval. This Agreement is subject to the Minnesota Government Data
Practice Act, Minnesota Statutes Chapter 13 (Data Practices Act). All government data, as
defined in the Data Practices Act Section 13.02, Subd 7, which is created, collected, received, stored, used, maintained, or disseminated by Consultant in performing any of the functions of the City during performance of this Agreement is subject to the requirements of the Data Practice Act and Consultant shall comply with those requirements as if it were
a government entity. All subcontracts entered into by Consultant in relation to this
Agreement shall contain similar Data Practices Act compliance language. 30. Waiver. Any waiver by either party of a breach of any provisions of this Agreement shall not affect, in any respect, the validity of the remainder of this Agreement.
Executed as of the day and year first written above. CITY OF EDEN PRAIRIE
Mayor
City Manager CONSULTANT
By:
Its:
EXHIBIT A
Requested Action
Move to: Approve the Professional Services Agreement for the Phase XI Pond Inventory and Inspection Program with Stantec, Inc., for $54,973.
Synopsis
The proposal from Stantec is to provide an inventory of the stormwater ponding system within the
subwatersheds of Anderson Lakes. The inventory will be used to select projects to improve the stormwater treatment system for Anderson Lakes. This project is the next step towards completing the citywide stormwater treatment inventory required by our Stormwater Permit Program. The cost of pond inventory will be paid out of the stormwater utility.
Background Information
The City has been working on inventorying our stormwater system since 2003. The current inspection program includes visual inspection of stormwater treatment areas (including lakes, ponds, wetlands, ditches, raingardens, drainage swales and creek segments) to identify problems
that require repair. The scope of work to complete the inventory was approved by the Minnesota
Pollution Control Agency on April 18, 2011. The City has identified approximately 23 public basins (ponds or wetlands modified to treat stormwater) that will require analysis within this study area. The services Stantec will provide
include items such as the following:
• Survey current depth and bathymetric contours for each selected water body.
• Develop models (P8 and BATHTUB) to evaluate the watershed and stormwater runoff entering the study area.
• Compare existing conditions with as-built information.
• Calculate the removal efficiency (%) for phosphorus and sediment.
• Determine which water bodies need sediment removal or other maintenance.
• Determine whether opportunities exist to upgrade functionality of the stormwater treatment system that may benefit the creek or lake.
The estimated cost for this phase based on evaluating 23 public basins is $54,973. This price assumes that the City will provide one or more interns to help with the fieldwork. Costs will be paid
from the storm water utility fund.
Attachments
Agreement
CITY COUNCIL AGENDA
SECTION: Consent Calendar
DATE:
May 7, 2024
DEPARTMENT/DIVISION:
Lori Haak Public Works / Engineering
ITEM DESCRIPTION: IC# 24806
Approve Professional Services Agreement with Stantec for Phase XI
Pond Inventory and Inspection Program
ITEM NO.:
VIII.K.
$JUHHPHQWIRU3URIHVVLRQDO6HUYLFHV
7KLV$JUHHPHQW ³$JUHHPHQW´ LVPDGHRQWKHBWKBGD\RIB BBBEHWZHHQ
WKH&LW\RI(GHQ3UDLULH0LQQHVRWD KHUHLQDIWHU³&LW\´ ZKRVHEXVLQHVVDGGUHVVLV0LWFKHOO
5RDG (GHQ 3UDLULH 01 DQG B6WDQWHF &RQVXOWLQJ 6HUYLFHV,QFB ³&RQVXOWDQW´ D
0LQQHVRWDBFRUSRUDWLRQB KHUHLQDIWHU ³&RQVXOWDQW´ ZKRVH EXVLQHVV DGGUHVVLVB2QH &DUOVRQ
3DUNZD\16XLWH3O\PRXWK01B
3UHOLPLQDU\6WDWHPHQW
7KH&LW\KDVDGRSWHGDSROLF\UHJDUGLQJWKHVHOHFWLRQDQGKLULQJRIFRQVXOWDQWVWRSURYLGHDYDULHW\
RISURIHVVLRQDOVHUYLFHVIRU&LW\SURMHFWV 7KDWSROLF\UHTXLUHVWKDWSHUVRQVILUPVRUFRUSRUDWLRQV
SURYLGLQJ VXFK VHUYLFHV HQWHU LQWR ZULWWHQ DJUHHPHQWV ZLWK WKH&LW\ 7KH SXUSRVH RI WKLV
$JUHHPHQWLVWRVHWIRUWKWKHWHUPVDQGFRQGLWLRQVIRUWKHSURYLVLRQRISURIHVVLRQDOVHUYLFHVE\
&RQVXOWDQWIRUBWKH3KDVH;,%DVLQ,QYHQWRU\DQG$VVHVVPHQW KHUHLQDIWHUUHIHUUHGWRDVWKH
³:RUN´
7KH&LW\DQG&RQVXOWDQWDJUHHDVIROORZV
6FRSHRI:RUN7KH&RQVXOWDQWDJUHHVWRSURYLGHWKHSURIHVVLRQDOVHUYLFHVVKRZQLQ
([KLELW$ 3URSRVDOGDWHG$SULO LQFRQQHFWLRQZLWKWKH:RUN ([KLELW$LV
LQWHQGHGWREHWKHVFRSHRIVHUYLFHIRUWKHZRUNRIWKH&RQVXOWDQW$Q\JHQHUDORUVSHFLILF
FRQGLWLRQVWHUPVDJUHHPHQWVFRQVXOWDQWRULQGXVWU\SURSRVDORUFRQWUDFWWHUPVDWWDFKHG
WRRUDSDUWRI([KLELW$DUHGHFOLQHGLQIXOODQGDFFRUGLQJO\DUHGHOHWHGDQGVKDOOQRWEH
LQHIIHFWLQDQ\PDQQHU
7HUP7KHWHUPRIWKLV$JUHHPHQWVKDOOEHIURPB0D\BWKURXJK-XO\B
WKHGDWHRIVLJQDWXUHE\WKHSDUWLHVQRWZLWKVWDQGLQJ 7KLV$JUHHPHQWPD\EHH[WHQGHG
XSRQWKHZULWWHQPXWXDOFRQVHQWRIWKHSDUWLHVIRUVXFKDGGLWLRQDOSHULRGDVWKH\GHHP
DSSURSULDWHDQGXSRQWKHWHUPVDQGFRQGLWLRQVDVKHUHLQVWDWHG
&RPSHQVDWLRQIRU6HUYLFHV&LW\DJUHHVWRSD\WKH&RQVXOWDQWRQDQKRXUO\EDVLVSOXV
H[SHQVHVLQDWRWDODPRXQWQRWWRH[FHHG IRUWKHVHUYLFHVDVGHVFULEHGLQ
([KLELW$
D$Q\FKDQJHVLQWKHVFRSHRIWKHZRUNZKLFKPD\UHVXOWLQDQLQFUHDVHWRWKH
FRPSHQVDWLRQ GXH WKH &RQVXOWDQW VKDOO UHTXLUH SULRU ZULWWHQ DSSURYDO E\ DQ
DXWKRUL]HGUHSUHVHQWDWLYHRIWKH&LW\RUE\WKH&LW\&RXQFLO7KH&LW\ZLOOQRWSD\
DGGLWLRQDOFRPSHQVDWLRQIRUVHUYLFHVWKDWGRQRWKDYHSULRUZULWWHQDXWKRUL]DWLRQ
E6SHFLDO &RQVXOWDQWV PD\ EH XWLOL]HG E\ WKH &RQVXOWDQW ZKHQ UHTXLUHG E\ WKH
FRPSOH[RUVSHFLDOL]HGQDWXUHRIWKH3URMHFWDQGZKHQDXWKRUL]HGLQZULWLQJE\WKH
&LW\
F,I&RQVXOWDQWLVGHOD\HGLQSHUIRUPDQFHGXHWRDQ\FDXVHEH\RQGLWVUHDVRQDEOH
FRQWUROLQFOXGLQJEXWQRWOLPLWHGWRVWULNHVULRWVILUHVSDQGHPLFVDFWVRI*RG
9HUVLRQ
3DJHRI
JRYHUQPHQWDODFWLRQVDFWLRQVRIDWKLUGSDUW\RUDFWLRQVRULQDFWLRQVRI&LW\WKH
WLPHIRUSHUIRUPDQFHVKDOOEHH[WHQGHGE\DSHULRGRIWLPHORVWE\UHDVRQRIWKH
GHOD\&RQVXOWDQWZLOOEHHQWLWOHGWRSD\PHQWIRULWVUHDVRQDEOHDGGLWLRQDOFKDUJHV
LIDQ\GXHWRWKHGHOD\
&LW\ ,QIRUPDWLRQ7KH &LW\ DJUHHV WR SURYLGH WKH &RQVXOWDQW ZLWK WKH FRPSOHWH
LQIRUPDWLRQFRQFHUQLQJWKH6FRSHRIWKH:RUNDQGWRSHUIRUPWKHIROORZLQJVHUYLFHV
D$FFHVVWRWKH$UHD 'HSHQGLQJRQWKHQDWXUHRIWKH:RUN&RQVXOWDQWPD\IURP
WLPHWRWLPHUHTXLUHDFFHVVWRSXEOLFDQGSULYDWHODQGVRUSURSHUW\ $VPD\EH
QHFHVVDU\WKH&LW\VKDOOREWDLQDFFHVVWRDQGPDNHDOOSURYLVLRQVIRUWKH&RQVXOWDQW
WRHQWHUXSRQSXEOLFDQGSULYDWHODQGVRUSURSHUW\DVUHTXLUHGIRUWKH&RQVXOWDQWWR
SHUIRUPVXFKVHUYLFHVQHFHVVDU\WRFRPSOHWHWKH:RUN
E&RQVLGHUDWLRQRIWKH&RQVXOWDQW
V:RUN7KH&LW\VKDOOJLYHWKRURXJKFRQVLGHUDWLRQ
WRDOOUHSRUWVVNHWFKHVHVWLPDWHVGUDZLQJVDQGRWKHUGRFXPHQWVSUHVHQWHGE\WKH
&RQVXOWDQWDQGVKDOOLQIRUPWKH&RQVXOWDQWRIDOOGHFLVLRQVUHTXLUHGRI&LW\ZLWKLQ
DUHDVRQDEOHWLPHVRDVQRWWRGHOD\WKHZRUNRIWKH&RQVXOWDQW
F6WDQGDUGV 7KH&LW\VKDOOIXUQLVKWKH&RQVXOWDQWZLWKDFRS\RIDQ\VWDQGDUGRU
FULWHULDLQFOXGLQJEXWQRWOLPLWHGWRGHVLJQDQGFRQVWUXFWLRQVWDQGDUGVWKDWPD\EH
UHTXLUHGLQWKHSUHSDUDWLRQRIWKH:RUNIRUWKH3URMHFW
G&LW\
V5HSUHVHQWDWLYH$SHUVRQVKDOOEHDSSRLQWHGWRDFWDVWKH&LW\
VUHSUHVHQWDWLYH
ZLWKUHVSHFWWRWKHZRUNWREHSHUIRUPHGXQGHUWKLV$JUHHPHQW+HRUVKHVKDOO
KDYHFRPSOHWHDXWKRULW\WRWUDQVPLWLQVWUXFWLRQVUHFHLYHLQIRUPDWLRQLQWHUSUHWDQG
GHILQHWKH&LW\
VSROLF\DQGGHFLVLRQVZLWKUHVSHFWWRWKHVHUYLFHVSURYLGHGRU
PDWHULDOVHTXLSPHQWHOHPHQWVDQGV\VWHPVSHUWLQHQWWRWKHZRUNFRYHUHGE\WKLV
$JUHHPHQW
0HWKRGRI3D\PHQW7KH&RQVXOWDQWVKDOOVXEPLWWRWKH&LW\RQDPRQWKO\EDVLVDQ
LWHPL]HG LQYRLFH IRU SURIHVVLRQDOVHUYLFHV SHUIRUPHG XQGHU WKLV $JUHHPHQW ,QYRLFHV
VXEPLWWHGVKDOOEHSDLGZLWKLQGD\VIURPUHFHLSWRILQYRLFH,QYRLFHVVXEPLWWHGVKDOOEH
SDLGLQWKHVDPHPDQQHUDVRWKHUFODLPVPDGHWRWKH&LW\IRU
D3URJUHVV3D\PHQW )RUZRUNUHLPEXUVHGRQDQKRXUO\EDVLVWKH&RQVXOWDQWVKDOO
LQGLFDWHIRUHDFKHPSOR\HHKLVRUKHUQDPHMREWLWOHWKHQXPEHURIKRXUVZRUNHG
UDWHRISD\IRUHDFKHPSOR\HHDFRPSXWDWLRQRIDPRXQWVGXHIRUHDFKHPSOR\HH
DQGWKHWRWDODPRXQWGXHIRUHDFKSURMHFWWDVN&RQVXOWDQWVKDOOYHULI\DOOVWDWHPHQWV
VXEPLWWHGIRUSD\PHQWLQFRPSOLDQFHZLWK0LQQHVRWD6WDWXWHV6HFWLRQVDQG
)RUUHLPEXUVDEOHH[SHQVHVLISURYLGHGIRULQ([KLELW$WKH&RQVXOWDQW
VKDOOSURYLGHDQLWHPL]HGOLVWLQJDQGVXFKGRFXPHQWDWLRQDVUHDVRQDEO\UHTXLUHGE\
WKH&LW\ (DFKLQYRLFHVKDOOFRQWDLQWKH&LW\¶VSURMHFWQXPEHUDQGDSURJUHVV
VXPPDU\VKRZLQJWKHRULJLQDO RUDPHQGHG DPRXQWRIWKHFRQWUDFWFXUUHQWELOOLQJ
SDVWSD\PHQWVDQGXQH[SHQGHGEDODQFHRIWKHFRQWUDFW
E6XVSHQGHG:RUN ,IDQ\ZRUNSHUIRUPHGE\WKH&RQVXOWDQWLVVXVSHQGHGLQZKROH
RULQSDUWE\WKH&LW\WKH&RQVXOWDQWVKDOOEHSDLGIRUDQ\VHUYLFHVVHWIRUWKRQ
3DJHRI
([KLELW$SHUIRUPHGSULRUWRUHFHLSWRIZULWWHQQRWLFHIURPWKH&LW\RIVXFK
VXVSHQVLRQ
F3D\PHQWVIRU6SHFLDO&RQVXOWDQWV7KH&RQVXOWDQWVKDOOEHUHLPEXUVHGIRUWKHZRUN
RIVSHFLDOFRQVXOWDQWVDVGHVFULEHGKHUHLQDQGIRURWKHULWHPVZKHQDXWKRUL]HGLQ
ZULWLQJE\WKH&LW\
G&ODLPV%\PDNLQJWKHFODLPIRUSD\PHQWWKHSHUVRQPDNLQJWKHFODLPLVGHFODULQJ
WKDWWKHDFFRXQWFODLPRUGHPDQGLVMXVWDQGFRUUHFWDQGWKDWQRSDUWRILWKDVEHHQ
SDLG
3URMHFW0DQDJHUDQG6WDIILQJ7KH&RQVXOWDQWVKDOOGHVLJQDWHD3URMHFW0DQDJHUDQG
QRWLI\WKH&LW\LQZULWLQJRIWKHLGHQWLW\RIWKH3URMHFW0DQDJHUEHIRUHVWDUWLQJZRUNRQWKH
3URMHFW 7KH3URMHFW0DQDJHUVKDOOEHDVVLVWHGE\RWKHUVWDIIPHPEHUVDVQHFHVVDU\WR
IDFLOLWDWHWKHFRPSOHWLRQRIWKH:RUNLQDFFRUGDQFHZLWKWKHWHUPVHVWDEOLVKHGKHUHLQ
&RQVXOWDQWPD\QRWUHPRYHRUUHSODFHWKH3URMHFW0DQDJHUZLWKRXWWKHDSSURYDORIWKH
&LW\
6WDQGDUGRI&DUH&RQVXOWDQWVKDOOH[HUFLVHWKHVDPHGHJUHHRIFDUHVNLOODQGGLOLJHQFH
LQWKHSHUIRUPDQFHRILWVVHUYLFHVDVLVRUGLQDULO\H[HUFLVHGE\PHPEHUVRIWKHSURIHVVLRQ
XQGHUVLPLODUFLUFXPVWDQFHVLQ+HQQHSLQ&RXQW\0LQQHVRWD &RQVXOWDQWVKDOOEHOLDEOHWR
WKHIXOOHVWH[WHQWSHUPLWWHGXQGHUDSSOLFDEOHODZZLWKRXWOLPLWDWLRQIRUDQ\LQMXULHVORVV
RUGDPDJHVSUR[LPDWHO\FDXVHGE\&RQVXOWDQW
VEUHDFKRIWKLVVWDQGDUGRIFDUH&RQVXOWDQW
VKDOOSXWIRUWKUHDVRQDEOHHIIRUWVWRFRPSOHWHLWVGXWLHVLQDFFRUGDQFHZLWKDPXWXDOO\
DJUHHGXSRQVFKHGXOH &RQVXOWDQWVKDOOQRWEHUHVSRQVLEOHIRUGHOD\VFDXVHGE\IDFWRUV
EH\RQGLWVFRQWURORUWKDWFRXOGQRWEHUHDVRQDEO\IRUHVHHQDWWKHWLPHRIH[HFXWLRQRIWKLV
$JUHHPHQW &RQVXOWDQWVKDOOEHUHVSRQVLEOHIRUFRVWVGHOD\VRUGDPDJHVDULVLQJIURP
XQUHDVRQDEOHGHOD\VLQWKHSHUIRUPDQFHRILWVGXWLHV
7HUPLQDWLRQ7KLV$JUHHPHQWPD\EHWHUPLQDWHGE\HLWKHUSDUW\E\VHYHQ GD\VZULWWHQ
QRWLFHGHOLYHUHGWRWKHRWKHUSDUW\DWWKHDGGUHVVZULWWHQDERYH 8SRQWHUPLQDWLRQXQGHU
WKLVSURYLVLRQLIWKHUHLVQRIDXOWRIWKH&RQVXOWDQWWKH&RQVXOWDQWVKDOOEHSDLGIRUVHUYLFHV
UHQGHUHGDQGUHLPEXUVDEOHH[SHQVHVXQWLOWKHHIIHFWLYHGDWHRIWHUPLQDWLRQ,IKRZHYHUWKH
&LW\WHUPLQDWHVWKH$JUHHPHQWEHFDXVHWKH&RQVXOWDQWKDVIDLOHGWRSHUIRUPLQDFFRUGDQFH
ZLWKWKLV$JUHHPHQWQRIXUWKHUSD\PHQWVKDOOEHPDGHWRWKH&RQVXOWDQWDQGWKH&LW\PD\
UHWDLQDQRWKHUFRQVXOWDQWWRXQGHUWDNHRUFRPSOHWHWKH:RUNLGHQWLILHGKHUHLQ
6XEFRQWUDFWRU7KH&RQVXOWDQWVKDOOQRWHQWHULQWRVXEFRQWUDFWVIRUVHUYLFHVSURYLGHG
XQGHUWKLV$JUHHPHQWH[FHSWDVQRWHGLQWKH6FRSHRI:RUNZLWKRXWWKHH[SUHVVZULWWHQ
FRQVHQW RI WKH &LW\ 7KH &RQVXOWDQW VKDOO SD\ DQ\ VXEFRQWUDFWRU LQYROYHG LQ WKH
SHUIRUPDQFHRIWKLV$JUHHPHQWZLWKLQWHQ GD\VRIWKH&RQVXOWDQW
VUHFHLSWRISD\PHQW
E\WKH&LW\IRUXQGLVSXWHGVHUYLFHVSURYLGHGE\WKHVXEFRQWUDFWRU ,IWKH&RQVXOWDQWIDLOV
ZLWKLQWKDWWLPHWRSD\WKHVXEFRQWUDFWRUDQ\XQGLVSXWHGDPRXQWIRUZKLFKWKH&RQVXOWDQW
KDVUHFHLYHGSD\PHQWE\WKH&LW\WKH&RQVXOWDQWVKDOOSD\LQWHUHVWWRWKHVXEFRQWUDFWRURQ
WKHXQSDLGDPRXQWDWWKHUDWHRISHUFHQWSHUPRQWKRUDQ\SDUWRIDPRQWK 7KH
PLQLPXPPRQWKO\LQWHUHVWSHQDOW\SD\PHQWIRUDQXQSDLGEDODQFHRIRUPRUHLV
3DJHRI
)RUDQXQSDLGEDODQFHRIOHVVWKDQWKH&RQVXOWDQWVKDOOSD\WKHDFWXDOLQWHUHVWSHQDOW\
GXHWRWKHVXEFRQWUDFWRU $VXEFRQWUDFWRUZKRSUHYDLOVLQDFLYLODFWLRQWRFROOHFWLQWHUHVW
SHQDOWLHVIURPWKH&RQVXOWDQWVKDOOEHDZDUGHGLWVFRVWVDQGGLVEXUVHPHQWVLQFOXGLQJ
DWWRUQH\
VIHHVLQFXUUHGLQEULQJLQJWKHDFWLRQ
,QGHSHQGHQW&RQVXOWDQW&RQVXOWDQWLVDQLQGHSHQGHQWFRQWUDFWRUHQJDJHGE\&LW\WR
SHUIRUPWKHVHUYLFHVGHVFULEHGKHUHLQDQGDVVXFK L VKDOOHPSOR\VXFKSHUVRQVDVLWVKDOO
GHHPQHFHVVDU\DQGDSSURSULDWHIRUWKHSHUIRUPDQFHRILWVREOLJDWLRQVSXUVXDQWWRWKLV
$JUHHPHQWZKRVKDOOEHHPSOR\HHVDQGXQGHUWKHGLUHFWLRQRI&RQVXOWDQWDQGLQQR
UHVSHFWHPSOR\HHVRI&LW\DQG LL VKDOOKDYHQRDXWKRULW\WRHPSOR\SHUVRQVRUPDNH
SXUFKDVHVRIHTXLSPHQWRQEHKDOIRI&LW\RURWKHUZLVHELQGRUREOLJDWH&LW\1RVWDWHPHQW
KHUHLQVKDOOEHFRQVWUXHGVRDVWRILQGWKH&RQVXOWDQWDQHPSOR\HHRIWKH&LW\
,QVXUDQFH
D*HQHUDO/LDELOLW\ 3ULRUWRVWDUWLQJWKH:RUN&RQVXOWDQWVKDOOSURFXUHPDLQWDLQDQG
SD\IRUVXFKLQVXUDQFHDVZLOOSURWHFWDJDLQVWFODLPVRUORVVZKLFKPD\DULVHRXWRI
RSHUDWLRQVE\&RQVXOWDQWRUE\DQ\VXEFRQWUDFWRURUE\DQ\RQHHPSOR\HGE\DQ\RI
WKHPRUE\DQ\RQHIRUZKRVHDFWVDQ\RIWKHPPD\EHOLDEOH6XFKLQVXUDQFHVKDOO
LQFOXGHEXWQRWEHOLPLWHGWRPLQLPXPFRYHUDJHVDQGOLPLWVRIOLDELOLW\VSHFLILHGLQ
WKLV3DUDJUDSKRUUHTXLUHGE\ODZ
E,I &RQVXOWDQW¶V LQVXUDQFH GRHV QRW DIIRUG FRYHUDJH RQ EHKDOI RI VXEFRQWUDFWRUV
&RQVXOWDQWPXVWUHTXLUHDQGYHULI\WKDWDOOVXEFRQWUDFWRUVPDLQWDLQLQVXUDQFHPHHWLQJ
DOOWKHUHTXLUHPHQWVRIWKLVSDUDJUDSKDQG&RQVXOWDQWPXVWLQFOXGHLQLWVFRQWUDFW
ZLWKVXEFRQWUDFWRUVWKHUHTXLUHPHQWWKDWWKH&LW\EHOLVWHGDVDQDGGLWLRQDOLQVXUHGRQ
LQVXUDQFH UHTXLUHG IURP VXEFRQWUDFWRUV ,Q VXFK FDVH SULRU WRD VXEFRQWUDFWRU
SHUIRUPLQJDQ\:RUNFRYHUHGE\WKLV$JUHHPHQW&RQVXOWDQWPXVW L SURYLGHWKH&LW\
ZLWKDFHUWLILFDWHRILQVXUDQFHLVVXHGE\WKHVXEFRQWUDFWRU¶VLQVXUDQFHDJHQWLQGLFDWLQJ
WKDWWKH&LW\LVDQDGGLWLRQDOLQVXUHGRQWKHVXEFRQWUDFWRU¶VLQVXUDQFHSROLF\ DQG LL
VXEPLWWRWKH&LW\DFRS\RI&RQVXOWDQW¶VDJUHHPHQWZLWKWKHVXEFRQWUDFWRUIRUSXUSRVHV
RIWKH&LW\¶VUHYLHZRIFRPSOLDQFHZLWKWKHUHTXLUHPHQWVRIWKLVSDUDJUDSK
F&RQVXOWDQWVKDOOSURFXUHDQGPDLQWDLQWKHIROORZLQJPLQLPXPLQVXUDQFHFRYHUDJHVDQG
OLPLWVRIOLDELOLW\IRUWKH:RUN
:RUNHU¶V&RPSHQVDWLRQ 6WDWXWRU\/LPLWV
(PSOR\HU¶V/LDELOLW\ HDFKDFFLGHQW
GLVHDVHSROLF\OLPLW
GLVHDVHHDFKHPSOR\HH
&RPPHUFLDO*HQHUDO SURSHUW\GDPDJHDQGERGLO\
/LDELOLW\LQMXU\SHURFFXUUHQFH
JHQHUDODJJUHJDWH
3URGXFWV±&RPSOHWHG2SHUDWLRQV
$JJUHJDWH
3DJHRI
ILUHOHJDOOLDELOLW\HDFKRFFXUUHQFH
PHGLFDOH[SHQVH
&RPSUHKHQVLYH$XWRPRELOH
/LDELOLW\FRPELQHGVLQJOHOLPLWHDFKDFFLGHQW
VKDOOLQFOXGHFRYHUDJHIRUDOORZQHGKLUHGDQG
QRQRZHGYHKLFOHV
8PEUHOODRU([FHVV/LDELOLW\
G&RPPHUFLDO*HQHUDO/LDELOLW\ 7KH&RPPHUFLDO*HQHUDO/LDELOLW\3ROLF\VKDOOEHRQ
,62IRUP&*RU&*RUWKHHTXLYDOHQW 6XFKLQVXUDQFHVKDOO
FRYHUOLDELOLW\DULVLQJIURPSUHPLVHVRSHUDWLRQVLQGHSHQGHQWFRQWUDFWRUVSURGXFWV
FRPSOHWHGRSHUDWLRQVSHUVRQDODQGDGYHUWLVLQJLQMXU\DQGOLDELOLW\DVVXPHGXQGHUDQ
LQVXUHGFRQWUDFW LQFOXGLQJWKHWRUWOLDELOLW\RIDQRWKHUDVVXPHGLQDEXVLQHVVFRQWUDFW
7KHUHVKDOOEHQRHQGRUVHPHQWRUPRGLILFDWLRQRIWKH&RPPHUFLDO*HQHUDO/LDELOLW\
IRUPDULVLQJIURPSROOXWLRQH[SORVLRQFROODSVHXQGHUJURXQGSURSHUW\GDPDJHRUZRUN
SHUIRUPHGE\VXEFRQWUDFWRUV
H3URIHVVLRQDO/LDELOLW\,QVXUDQFH ,QDGGLWLRQWRWKHFRYHUDJHVOLVWHGDERYH&RQVXOWDQW
VKDOOPDLQWDLQDSURIHVVLRQDOOLDELOLW\LQVXUDQFHSROLF\LQWKHDPRXQWRI
6DLGSROLF\QHHGQRWQDPHWKH&LW\DVDQDGGLWLRQDOLQVXUHG ,WVKDOOEH&RQVXOWDQW¶V
UHVSRQVLELOLW\WRSD\DQ\UHWHQWLRQRUGHGXFWLEOHIRUWKHSURIHVVLRQDOOLDELOLW\LQVXUDQFH
&RQVXOWDQWDJUHHVWRPDLQWDLQWKHSURIHVVLRQDOOLDELOLW\LQVXUDQFHIRUDPLQLPXPRIWZR
\HDUVIROORZLQJWHUPLQDWLRQRIWKLV$JUHHPHQW
I&RQVXOWDQW VKDOO PDLQWDLQ ³VWRS JDS´ FRYHUDJH LI &RQVXOWDQW REWDLQV :RUNHUV¶
&RPSHQVDWLRQFRYHUDJHIURPDQ\VWDWHIXQGLI(PSOR\HU¶VOLDELOLW\FRYHUDJHLVQRW
DYDLODEOH
J$OO SROLFLHV H[FHSW WKH :RUNHU¶V &RPSHQVDWLRQ 3ROLF\ $XWRPRELOH 3ROLF\ DQG
3URIHVVLRQDO/LDELOLW\3ROLF\VKDOOQDPHWKH³&LW\RI(GHQ3UDLULH´DVDQDGGLWLRQDO
LQVXUHGLQFOXGLQJSURGXFWVDQGFRPSOHWHGRSHUDWLRQV
K$OOSROLFLHVH[FHSWWKH3URIHVVLRQDO/LDELOLW\3ROLF\VKDOODSSO\RQD³SHUSURMHFW´
EDVLV
L$OO*HQHUDO/LDELOLW\SROLFLHV$XWRPRELOH/LDELOLW\SROLFLHVDQG8PEUHOODSROLFLHV
VKDOOFRQWDLQDZDLYHURIVXEURJDWLRQLQIDYRURIWKH&LW\
M$OO SROLFLHV H[FHSW IRU WKH :RUNHU¶V &RPSHQVDWLRQ 3ROLF\ DQG WKH 3URIHVVLRQDO
/LDELOLW\3ROLF\VKDOOEHSULPDU\DQGQRQFRQWULEXWRU\
N$OOSROLFHVH[FHSWWKH:RUNHU¶V&RPSHQVDWLRQ3ROLF\VKDOOLQVXUHWKHGHIHQVHDQG
LQGHPQLW\REOLJDWLRQVDVVXPHGE\&RQVXOWDQWXQGHUWKLV$JUHHPHQW 7KH3URIHVVLRQDO
/LDELOLW\ SROLF\ VKDOO LQVXUH WKH GHIHQVH DQG LQGHPQLW\ REOLJDWLRQV DVVXPHG E\
3DJHRI
&RQVXOWDQWXQGHUWKLV$JUHHPHQWH[FHSWZLWKUHVSHFWWRWKHOLDELOLW\IRUORVVRUGDPDJH
UHVXOWLQJIURPWKHQHJOLJHQFHRUIDXOWRIDQ\RQHRWKHUWKDQWKH&RQVXOWDQWRURWKHUVIRU
ZKRPWKH&RQVXOWDQWLVOHJDOO\OLDEOH
O&RQVXOWDQWDJUHHVWRPDLQWDLQDOOFRYHUDJHUHTXLUHGKHUHLQWKURXJKRXWWKHWHUPRIWKH
$JUHHPHQWDQGIRUDPLQLPXPRIWZR \HDUVIROORZLQJ&LW\¶VZULWWHQDFFHSWDQFHRI
WKH:RUN
P,W VKDOO EH &RQVXOWDQW¶V UHVSRQVLELOLW\ WR SD\ DQ\ UHWHQWLRQ RU GHGXFWLEOH IRU WKH
FRYHUDJHVUHTXLUHGKHUHLQ
Q$OO SROLFLHV VKDOO FRQWDLQ D SURYLVLRQ RU HQGRUVHPHQW WKDW FRYHUDJHV DIIRUGHG
WKHUHXQGHUVKDOOQRWEHFDQFHOOHGRUQRQUHQHZHGRUUHVWULFWLYHPRGLILFDWLRQVDGGHG
ZLWKRXWWKLUW\ GD\V¶SULRUQRWLFHWRWKH&LW\H[FHSWWKDWLIWKHFDQFHOODWLRQRUQRQ
UHQHZDOLVGXHWRQRQSD\PHQWWKHFRYHUDJHVPD\QRWEHWHUPLQDWHGRUQRQUHQHZHG
ZLWKRXWWHQ GD\V¶SULRUQRWLFHWRWKH&LW\
R&RQVXOWDQW VKDOO PDLQWDLQ LQ HIIHFW DOO LQVXUDQFH FRYHUDJHV UHTXLUHG XQGHU WKLV
3DUDJUDSKDW&RQVXOWDQW¶VVROHH[SHQVHDQGZLWKLQVXUDQFHFRPSDQLHVOLFHQVHGWRGR
EXVLQHVVLQWKHVWDWHLQ0LQQHVRWDDQGKDYLQJDFXUUHQW$0%HVWUDWLQJRIQROHVVWKDQ
$XQOHVVVSHFLILFDOO\DFFHSWHGE\&LW\LQZULWLQJ
S$ FRS\ RI WKH &RQVXOWDQW¶V &HUWLILFDWH RI ,QVXUDQFH ZKLFK HYLGHQFHV WKH
FRPSOLDQFHZLWKWKLV3DUDJUDSKPXVWEHILOHGZLWK&LW\SULRUWRWKHVWDUWRI
&RQVXOWDQW¶V:RUN8SRQUHTXHVWDFRS\RIWKH&RQVXOWDQW¶VLQVXUDQFHGHFODUDWLRQ
SDJH5LGHUDQGRU(QGRUVHPHQWDVDSSOLFDEOHVKDOOEHSURYLGHG 6XFKGRFXPHQWV
HYLGHQFLQJ,QVXUDQFHVKDOOEHLQDIRUPDFFHSWDEOHWR&LW\DQGVKDOOSURYLGHVDWLVIDFWRU\
HYLGHQFH WKDW &RQVXOWDQW KDV FRPSOLHG ZLWK DOO LQVXUDQFH UHTXLUHPHQWV 5HQHZDO
FHUWLILFDWHVVKDOOEHSURYLGHGWR&LW\SULRUWRWKHH[SLUDWLRQGDWHRIDQ\RIWKHUHTXLUHG
SROLFLHV&LW\ZLOOQRWEHREOLJDWHGKRZHYHUWRUHYLHZVXFK&HUWLILFDWHRI,QVXUDQFH
GHFODUDWLRQSDJH5LGHU(QGRUVHPHQWRUFHUWLILFDWHVRURWKHUHYLGHQFHRILQVXUDQFHRU
WRDGYLVH&RQVXOWDQWRIDQ\GHILFLHQFLHVLQVXFKGRFXPHQWVDQGUHFHLSWWKHUHRIVKDOO
QRWUHOLHYH&RQVXOWDQWIURPQRUEHGHHPHGDZDLYHURI&LW\¶VULJKWWRHQIRUFHWKH
WHUPVRI&RQVXOWDQW¶VREOLJDWLRQVKHUHXQGHU&LW\UHVHUYHVWKHULJKWWRH[DPLQHDQ\
SROLF\SURYLGHGIRUXQGHUWKLVSDUDJUDSK
T(IIHFWRI&RQVXOWDQW¶V)DLOXUHWR3URYLGH,QVXUDQFH,I&RQVXOWDQWIDLOVWRSURYLGHWKH
VSHFLILHGLQVXUDQFHWKHQ&RQVXOWDQWZLOOGHIHQGLQGHPQLI\DQGKROGKDUPOHVVWKH&LW\
WKH&LW\
VRIILFLDOV DJHQWVDQGHPSOR\HHVIURPDQ\ORVVFODLPOLDELOLW\DQGH[SHQVH
LQFOXGLQJUHDVRQDEOHDWWRUQH\
VIHHVDQGH[SHQVHVRIOLWLJDWLRQ WRWKHH[WHQWQHFHVVDU\
WRDIIRUGWKHVDPHSURWHFWLRQDVZRXOGKDYHEHHQSURYLGHGE\WKHVSHFLILHGLQVXUDQFH
([FHSWWRWKHH[WHQWSURKLELWHGE\ODZWKLVLQGHPQLW\DSSOLHVUHJDUGOHVVRIDQ\VWULFW
OLDELOLW\RUQHJOLJHQFHDWWULEXWDEOHWRWKH&LW\ LQFOXGLQJVROHQHJOLJHQFH DQGUHJDUGOHVV
RIWKHH[WHQWWRZKLFKWKHXQGHUO\LQJRFFXUUHQFH LHWKHHYHQWJLYLQJULVHWRDFODLP
ZKLFK ZRXOG KDYH EHHQ FRYHUHG E\ WKH VSHFLILHG LQVXUDQFH LV DWWULEXWDEOHWRWKH
QHJOLJHQWRURWKHUZLVHZURQJIXODFWRURPLVVLRQ LQFOXGLQJEUHDFKRIFRQWUDFW RI
3DJHRI
&RQVXOWDQWLWVVXEFRQWUDFWRUVDJHQWVHPSOR\HHVRUGHOHJDWHV &RQVXOWDQWDJUHHVWKDW
WKLVLQGHPQLW\VKDOOEHFRQVWUXHGDQGDSSOLHGLQIDYRURILQGHPQLILFDWLRQ &RQVXOWDQW
DOVRDJUHHVWKDWLIDSSOLFDEOHODZOLPLWVRUSUHFOXGHVDQ\DVSHFWRIWKLVLQGHPQLW\WKHQ
WKHLQGHPQLW\ZLOOEHFRQVLGHUHGOLPLWHGRQO\WRWKHH[WHQWQHFHVVDU\WRFRPSO\ZLWKWKDW
DSSOLFDEOHODZ7KHVWDWHGLQGHPQLW\FRQWLQXHVXQWLODOODSSOLFDEOHVWDWXWHVRIOLPLWDWLRQ
KDYHUXQ
,IDFODLPDULVHVZLWKLQWKHVFRSHRIWKHVWDWHGLQGHPQLW\WKH&LW\PD\UHTXLUH&RQVXOWDQW
WR
L)XUQLVKDQGSD\IRUDVXUHW\ERQGVDWLVIDFWRU\WRWKH&LW\JXDUDQWHHLQJ
SHUIRUPDQFHRIWKHLQGHPQLW\REOLJDWLRQ RU
LL)XUQLVK D ZULWWHQ DFFHSWDQFH RI WHQGHU RI GHIHQVH DQG LQGHPQLW\ IURP
&RQVXOWDQW
VLQVXUDQFHFRPSDQ\
&RQVXOWDQWZLOOWDNHWKHDFWLRQUHTXLUHGE\WKH&LW\ZLWKLQILIWHHQ GD\VRIUHFHLYLQJ
QRWLFHIURPWKH&LW\
,QGHPQLILFDWLRQ &RQVXOWDQWZLOOGHIHQGDQGLQGHPQLI\&LW\LWVRIILFHUVDJHQWVDQG
HPSOR\HHVDQGKROGWKHPKDUPOHVVIURPDQGDJDLQVWDOOMXGJPHQWVGDPDJHVFRVWVDQG
H[SHQVHVLQFOXGLQJDUHDVRQDEOHDPRXQWDVDQGIRULWVDWWRUQH\¶VIHHVSDLGLQFXUUHGRUIRU
ZKLFKLWPD\EHOLDEOHUHVXOWLQJIURPDQ\EUHDFKRIWKLV$JUHHPHQWE\&RQVXOWDQWLWV
DJHQWVFRQWUDFWRUVDQGHPSOR\HHVRUWRWKHH[WHQWFDXVHGE\DQ\QHJOLJHQWRULQWHQWLRQDO
DFWRURPLVVLRQSHUIRUPHGWDNHQRUQRWSHUIRUPHGRUWDNHQE\&RQVXOWDQWLWVDJHQWV
FRQWUDFWRUV DQG HPSOR\HHV UHODWLYH WR WKLV $JUHHPHQW &LW\ ZLOO LQGHPQLI\ DQG KROG
&RQVXOWDQWKDUPOHVVIURPDQGDJDLQVWDQ\ORVVIRULQMXULHVRUGDPDJHVWRWKHH[WHQWFDXVHG
E\WKHQHJOLJHQWDFWVRIWKH&LW\LWVRIILFHUVDJHQWVRUHPSOR\HHV
2ZQHUVKLSRI'RFXPHQWV8SRQIXOOSD\PHQWRIDOOPRQLHVRZHGWR&RQVXOWDQW$OO
SODQV GLDJUDPV DQDO\VHV UHSRUWV DQG LQIRUPDWLRQ JHQHUDWHG LQ FRQQHFWLRQ ZLWK WKH
SHUIRUPDQFHRIWKH$JUHHPHQW ³,QIRUPDWLRQ´ VKDOOEHFRPHWKHSURSHUW\RIWKH&LW\EXW
&RQVXOWDQWPD\UHWDLQFRSLHVRIVXFKGRFXPHQWVDVUHFRUGVRIWKHVHUYLFHVSURYLGHG7KH
&LW\ PD\ XVH WKH ,QIRUPDWLRQ IRULWV SXUSRVHV DQG WKH &RQVXOWDQWDOVRPD\XVHWKH
,QIRUPDWLRQ IRU LWV SXUSRVHV 8VH RI WKH ,QIRUPDWLRQ IRU WKH SXUSRVHV RI WKH SURMHFW
FRQWHPSODWHGE\WKLV$JUHHPHQW ³3URMHFW´ GRHVQRWUHOLHYHDQ\OLDELOLW\RQWKHSDUWRIWKH
&RQVXOWDQWEXWDQ\XVHRIWKH,QIRUPDWLRQE\WKH&LW\RUWKH&RQVXOWDQWEH\RQGWKHVFRSH
RIWKH3URMHFWLVZLWKRXWOLDELOLW\WRWKHRWKHUDQGWKHSDUW\XVLQJWKH,QIRUPDWLRQDJUHHVWR
GHIHQGDQGLQGHPQLI\WKHRWKHUIURPDQ\FODLPVRUOLDELOLW\UHVXOWLQJWKHUHIURP
0HGLDWLRQ (DFKGLVSXWHFODLPRUFRQWURYHUV\DULVLQJIURPRUUHODWHGWRWKLVDJUHHPHQW
VKDOOEHVXEMHFWWRPHGLDWLRQDVDFRQGLWLRQSUHFHGHQWWRLQLWLDWLQJDUELWUDWLRQRUOHJDORU
HTXLWDEOHDFWLRQVE\HLWKHUSDUW\ 8QOHVVWKHSDUWLHVDJUHHRWKHUZLVHWKHPHGLDWLRQVKDOO
EHLQDFFRUGDQFHZLWKWKH&RPPHUFLDO0HGLDWLRQ3URFHGXUHVRIWKH$PHULFDQ$UELWUDWLRQ
$VVRFLDWLRQWKHQFXUUHQWO\LQHIIHFW $UHTXHVWIRUPHGLDWLRQVKDOOEHILOHGLQZULWLQJZLWK
WKH $PHULFDQ $UELWUDWLRQ $VVRFLDWLRQ DQG WKH RWKHU SDUW\ 1R DUELWUDWLRQRUOHJDORU
HTXLWDEOHDFWLRQPD\EHLQVWLWXWHGIRUDSHULRGRI GD\VIURPWKHILOLQJRIWKHUHTXHVWIRU
PHGLDWLRQXQOHVVDORQJHUSHULRGRIWLPHLVSURYLGHGE\DJUHHPHQWRIWKHSDUWLHV &RVWRI
PHGLDWLRQVKDOOEHVKDUHGHTXDOO\EHWZHHQWKHSDUWLHV 0HGLDWLRQVKDOOEHKHOGLQWKH&LW\
RI(GHQ3UDLULHXQOHVVDQRWKHUORFDWLRQLVPXWXDOO\DJUHHGXSRQE\WKHSDUWLHV7KHSDUWLHV
3DJHRI
VKDOOPHPRULDOL]HDQ\DJUHHPHQWUHVXOWLQJIURPWKHPHGLDWLRQLQDPHGLDWHGVHWWOHPHQW
DJUHHPHQWZKLFKDJUHHPHQWVKDOOEHHQIRUFHDEOHDVDVHWWOHPHQWLQDQ\FRXUWKDYLQJ
MXULVGLFWLRQWKHUHRI
*(1(5$/7(506$1'&21',7,216
$VVLJQPHQW1HLWKHUSDUW\VKDOODVVLJQWKLV$JUHHPHQWQRUDQ\LQWHUHVWDULVLQJKHUHLQ
ZLWKRXWWKHZULWWHQFRQVHQWRIWKHRWKHUSDUW\
&RPSOLDQFHZLWK/DZVDQG5HJXODWLRQV,QSURYLGLQJVHUYLFHVKHUHXQGHUWKH&RQVXOWDQW
VKDOODELGHE\VWDWXWHVRUGLQDQFHVUXOHVDQGUHJXODWLRQVSHUWDLQLQJWRWKHSURYLVLRQVRI
VHUYLFHV WR EH SURYLGHG $Q\ YLRODWLRQ RI VWDWXWHV RUGLQDQFHV UXOHV DQG UHJXODWLRQV
SHUWDLQLQJ WR WKH VHUYLFHV WR EH SURYLGHG VKDOO FRQVWLWXWH D PDWHULDO EUHDFK RI WKLV
$JUHHPHQWDQGHQWLWOHWKH&LW\WRLPPHGLDWHO\WHUPLQDWHWKLV$JUHHPHQW
&RQIOLFWV1RVDODULHGRIILFHURUHPSOR\HHRIWKH&LW\DQGQRPHPEHURIWKH&RXQFLORI
WKH&LW\VKDOOKDYHDILQDQFLDOLQWHUHVWGLUHFWRULQGLUHFWLQWKLV$JUHHPHQW7KHYLRODWLRQ
RIWKLVSURYLVLRQUHQGHUVWKH$JUHHPHQWYRLG
&RXQWHUSDUWV7KLV$JUHHPHQWPD\EHH[HFXWHGLQPXOWLSOHFRXQWHUSDUWVHDFKRIZKLFK
VKDOOEHFRQVLGHUHGDQRULJLQDO
'DPDJHV ,QWKHHYHQWRIDEUHDFKRIWKLV$JUHHPHQWE\HLWKHUSDUW\WKHQRQEUHDFKLQJ
SDUW\ VKDOO QRW EH HQWLWOHG WR UHFRYHU SXQLWLYH VSHFLDO RU FRQVHTXHQWLDO GDPDJHV RU
GDPDJHVIRUORVVRIEXVLQHVV
(PSOR\HHV &RQWUDFWRUDJUHHVQRWWRKLUHDQ\HPSOR\HHRUIRUPHUHPSOR\HHRI&LW\DQG
&LW\DJUHHVQRWWRKLUHDQ\HPSOR\HHRUIRUPHUHPSOR\HHRI&RQWUDFWRUSULRUWRWHUPLQDWLRQ
RIWKLV$JUHHPHQWDQGIRURQH \HDUWKHUHDIWHUZLWKRXWSULRUZULWWHQFRQVHQWRIWKH
IRUPHUHPSOR\HULQHDFKFDVH
(QIRUFHPHQW 7KH &RQWUDFWRU VKDOO UHLPEXUVH WKH &LW\ IRU DOO FRVWV DQG H[SHQVHV
LQFOXGLQJZLWKRXWOLPLWDWLRQDWWRUQH\V
IHHVSDLGRULQFXUUHGE\WKH&LW\LQFRQQHFWLRQZLWK
WKHHQIRUFHPHQWE\WKH&LW\GXULQJWKHWHUPRIWKLV$JUHHPHQWRUWKHUHDIWHURIDQ\RIWKH
ULJKWVRUUHPHGLHVRIWKH&LW\XQGHUWKLV$JUHHPHQW
(QWLUH$JUHHPHQW&RQVWUXFWLRQ$SSOLFDWLRQDQG,QWHUSUHWDWLRQ7KLV$JUHHPHQWLV
LQIXUWKHUDQFHRIWKH&LW\¶VSXEOLFSXUSRVHPLVVLRQDQGVKDOOEHFRQVWUXHGLQWHUSUHWHGDQG
DSSOLHGSXUVXDQWWRDQGLQFRQIRUPDQFHZLWKWKH&LW\
VSXEOLFSXUSRVHPLVVLRQ7KHHQWLUH
DJUHHPHQWRIWKHSDUWLHVLVFRQWDLQHGKHUHLQ 7KLV&RQWUDFWVXSHUVHGHVDOORUDODJUHHPHQWV
DQGQHJRWLDWLRQVEHWZHHQWKHSDUWLHVUHODWLQJWRWKHVXEMHFWPDWWHUKHUHRIDVZHOODVDQ\
SUHYLRXVDJUHHPHQWVSUHVHQWO\LQHIIHFWEHWZHHQWKHSDUWLHVUHODWLQJWRWKHVXEMHFWPDWWHU
KHUHRI$Q\DOWHUDWLRQVDPHQGPHQWVGHOHWLRQVRUZDLYHUVRIWKHSURYLVLRQVRIWKLV
3DJH RI
&RQWUDFWVKDOOEHYDOLGRQO\ZKHQH[SUHVVHGLQZULWLQJDQGGXO\VLJQHGE\WKHSDUWLHV
XQOHVVRWKHUZLVHSURYLGHGKHUHLQ
*RYHUQLQJ/DZ7KLV$JUHHPHQWVKDOOEHFRQWUROOHGE\WKHODZVRIWKH6WDWHRI0LQQHVRWD
1RQ'LVFULPLQDWLRQ'XULQJWKHSHUIRUPDQFHRIWKLV$JUHHPHQWWKH&RQVXOWDQWVKDOOQRW
GLVFULPLQDWHDJDLQVWDQ\HPSOR\HHRUDSSOLFDQWVIRUHPSOR\PHQWEHFDXVHRIUDFHFRORU
FUHHGUHOLJLRQQDWLRQDORULJLQVH[PDULWDOVWDWXVVWDWXVZLWKUHJDUGWRSXEOLFDVVLVWDQFH
GLVDELOLW\VH[XDORULHQWDWLRQRUDJH 7KH&RQVXOWDQWVKDOOSRVWLQSODFHVDYDLODEOHWR
HPSOR\HHVDQGDSSOLFDQWVIRUHPSOR\PHQWQRWLFHVVHWWLQJIRUWKWKHSURYLVLRQRIWKLVQRQ
GLVFULPLQDWLRQFODXVHDQGVWDWLQJWKDWDOOTXDOLILHGDSSOLFDQWVZLOOUHFHLYHFRQVLGHUDWLRQIRU
HPSOR\PHQW 7KH &RQVXOWDQW VKDOOLQFRUSRUDWH WKH IRUHJRLQJ UHTXLUHPHQWV RI WKLV
SDUDJUDSK LQ DOO RI LWV VXEFRQWUDFWV IRU SURJUDP ZRUN DQG ZLOO UHTXLUH DOO RI LWV
VXEFRQWUDFWRUVIRUVXFK ZRUNWRLQFRUSRUDWHVXFKUHTXLUHPHQWVLQDOOVXEFRQWUDFWVIRU
SURJUDPZRUN 7KH&RQVXOWDQWIXUWKHUDJUHHVWRFRPSO\ZLWKDOODVSHFWVRIWKH0LQQHVRWD
+XPDQ5LJKWV$FW0LQQHVRWD6WDWXWHVHWVHT7LWOH9,RIWKH&LYLO5LJKWV$FWRI
DQGWKH$PHULFDQVZLWK'LVDELOLWLHV$FWRI
1RWLFH$Q\QRWLFHUHTXLUHGRUSHUPLWWHGWREHJLYHQE\DSDUW\XSRQWKHRWKHULVJLYHQLQ
DFFRUGDQFHZLWKWKLV$JUHHPHQWLILWLVGLUHFWHGWRHLWKHUSDUW\E\GHOLYHULQJLWSHUVRQDOO\
WRDQRIILFHURIWKHSDUW\RULIPDLOHGLQDVHDOHGZUDSSHUE\8QLWHG6WDWHVUHJLVWHUHGRU
FHUWLILHGPDLOUHWXUQUHFHLSWUHTXHVWHGSRVWDJHSUHSDLGRULIGHSRVLWHGFRVWSDLGZLWKD
QDWLRQDOO\UHFRJQL]HGUHSXWDEOHRYHUQLJKWFRXULHUSURSHUO\DGGUHVVHGWRWKHDGGUHVVOLVWHG
RQSDJHKHUHRI 1RWLFHVVKDOOEHGHHPHGHIIHFWLYHRQWKHHDUOLHURIWKHGDWHRIUHFHLSWRU
WKHGDWHRIPDLOLQJRUGHSRVLWDVDIRUHVDLGSURYLGHGKRZHYHUWKDWLIQRWLFHLVJLYHQE\
PDLORUGHSRVLWWKDWWKHWLPHIRUUHVSRQVHWRDQ\QRWLFHE\WKHRWKHUSDUW\VKDOOFRPPHQFH
WRUXQRQHEXVLQHVVGD\DIWHUDQ\VXFKPDLOLQJRUGHSRVLW $SDUW\PD\FKDQJHLWVDGGUHVV
IRUWKHVHUYLFHRIQRWLFHE\JLYLQJZULWWHQQRWLFHRIVXFKFKDQJHWRWKHRWKHUSDUW\LQDQ\
PDQQHUDERYHVSHFLILHGGD\VSULRUWRWKHHIIHFWLYHGDWHRIVXFKFKDQJH
5LJKWVDQG5HPHGLHV7KHGXWLHVDQGREOLJDWLRQVLPSRVHGE\WKLV$JUHHPHQWDQGWKH
ULJKWVDQGUHPHGLHVDYDLODEOHWKHUHXQGHUVKDOOEHLQDGGLWLRQWRDQGQRWDOLPLWDWLRQRIDQ\
GXWLHVREOLJDWLRQVULJKWVDQGUHPHGLHVRWKHUZLVHLPSRVHGRUDYDLODEOHE\ODZ
6HUYLFHV 1RW 3URYLGHG )RU1R FODLP IRU VHUYLFHV IXUQLVKHG E\ WKH &RQVXOWDQW QRW
VSHFLILFDOO\SURYLGHGIRUKHUHLQVKDOOEHKRQRUHGE\WKH&LW\
6HYHUDELOLW\7KHSURYLVLRQVRIWKLV$JUHHPHQWDUHVHYHUDEOH ,IDQ\SRUWLRQKHUHRILVIRU
DQ\UHDVRQKHOGE\DFRXUWRIFRPSHWHQWMXULVGLFWLRQWREHFRQWUDU\WRODZVXFKGHFLVLRQ
VKDOOQRWDIIHFWWKHUHPDLQLQJSURYLVLRQVRIWKLV$JUHHPHQW
6WDWXWRU\3URYLVLRQV
D$XGLW'LVFORVXUH7KHERRNVUHFRUGVGRFXPHQWVDQGDFFRXQWLQJSURFHGXUHVDQG
SUDFWLFHVRIWKH&RQVXOWDQWRURWKHUSDUWLHVUHOHYDQWWRWKLV$JUHHPHQWDUHVXEMHFWWR
3DJHRI
H[DPLQDWLRQE\WKH&LW\DQGHLWKHUWKH/HJLVODWLYH$XGLWRURUWKH6WDWH$XGLWRUIRUDSHULRG
RIVL[ \HDUVDIWHUWKHHIIHFWLYHGDWHRIWKLV$JUHHPHQW1RWZLWKVWDQGLQJWKHIRUHJRLQJWKH
&LW\¶VULJKWWRLQVSHFWFRS\DQGDXGLWVKDOOQRWH[WHQGWRWKHFRPSRVLWLRQRIWKH&RQWUDFWRU¶VUDWHVDQGIHHV
SHUFHQWDJHPDUNXSVRUPXOWLSOLHUVEXWVKDOODSSO\RQO\WRWKHLUDSSOLFDWLRQWRWKHDSSOLFDEOHXQLWV
E'DWD3UDFWLFHV $Q\UHSRUWVLQIRUPDWLRQRUGDWDLQDQ\IRUPJLYHQWRRUSUHSDUHG
RUDVVHPEOHGE\WKH&RQVXOWDQWXQGHUWKLV$JUHHPHQWZKLFKWKH&LW\UHTXHVWVWREHNHSW
FRQILGHQWLDOVKDOOQRWEHPDGHDYDLODEOHWRDQ\LQGLYLGXDORURUJDQL]DWLRQZLWKRXWWKH
&LW\
VSULRUZULWWHQDSSURYDO7KLV$JUHHPHQWLVVXEMHFWWRWKH0LQQHVRWD*RYHUQPHQW'DWD
3UDFWLFH$FW0LQQHVRWD6WDWXWHV&KDSWHU 'DWD3UDFWLFHV$FW $OOJRYHUQPHQWGDWDDV
GHILQHGLQWKH'DWD3UDFWLFHV$FW6HFWLRQ6XEGZKLFKLVFUHDWHGFROOHFWHG
UHFHLYHGVWRUHGXVHGPDLQWDLQHGRUGLVVHPLQDWHGE\&RQVXOWDQWLQSHUIRUPLQJDQ\RIWKH
IXQFWLRQVRIWKH&LW\GXULQJSHUIRUPDQFHRIWKLV$JUHHPHQWLVVXEMHFWWRWKHUHTXLUHPHQWV
RIWKH'DWD3UDFWLFH$FWDQG&RQVXOWDQWVKDOOFRPSO\ZLWKWKRVHUHTXLUHPHQWVDVLILWZHUH
D JRYHUQPHQW HQWLW\ $OO VXEFRQWUDFWV HQWHUHG LQWR E\ &RQVXOWDQW LQ UHODWLRQ WR WKLV
$JUHHPHQWVKDOOFRQWDLQVLPLODU'DWD3UDFWLFHV$FWFRPSOLDQFHODQJXDJH
:DLYHU$Q\ZDLYHUE\HLWKHUSDUW\RIDEUHDFKRIDQ\SURYLVLRQVRIWKLV$JUHHPHQWVKDOO
QRWDIIHFWLQDQ\UHVSHFWWKHYDOLGLW\RIWKHUHPDLQGHURIWKLV$JUHHPHQW
([HFXWHGDVRIWKHGD\DQG\HDUILUVWZULWWHQDERYH
&,7<2)('(135$,5,(
0D\RU
&LW\0DQDJHU
67$17(&&2168/7,1*6(59,&(6,1&
%\
,WV
Josh Accola
Water Resources Engineer/Project Manager
Accola, Joshua Digitally signed by Accola, JoshuaDN: CN="Accola, Joshua", OU=Internal, OU=users, OU=stantec, DC=corp, DC=adsDate: 2024.04.30 14:12:09-05'00'
6WDQWHF&RQVXOWLQJ6HUYLFHV,QF
2QH&DUOVRQ3DUNZD\1RUWK
3O\PRXWK01
$SULO
/RUL+DDN
:DWHU5HVRXUFHV&RRUGLQDWRU
0LWFKHOO5RDG
(GHQ3UDLULH01
'HDU0V+DDN
5HIHUHQFH 3KDVH%DVLQ,QYHQWRU\DQG$VVHVVPHQW
7KDQN\RXIRUWKLVRSSRUWXQLW\WRSUHVHQWWKLVSURSRVDOWRWKH&LW\RI(GHQ3UDLULHIRU3KDVH%DVLQ
,QYHQWRU\DQG$VVHVVPHQW6WDQWHFLVH[FLWHGWRKHOSWKH&LW\ZLWKDVVHVVLQJSXEOLFVWRUPZDWHUEDVLQ
IXQFWLRQDOLW\LQWKH$QGHUVRQ/DNHVZDWHUVKHGV2XUWHDPKDVFRQVLGHUDEOHH[SHULHQFHLQSURYLGLQJWKH
QHFHVVDU\*,6LQVSHFWLRQPRGHOLQJDQGUHSRUWLQJVHUYLFHVIRUWKLVSURMHFW6WDQWHFZLOOFRQWLQXHWREXLOG
RQWKHSUHYLRXVSKDVHVRIWKHLQYHQWRU\DQGDVVHVVPHQWE\LGHQWLI\LQJPDLQWHQDQFHQHHGVDQG
RSSRUWXQLWLHVIRUVWRUPZDWHULPSURYHPHQWV6WDQWHF¶VWHDPFRQVLVWVRIZHOOTXDOLILHGHQJLQHHUVDQGVFLHQWLVW
WKDWDUHUHVSRQVLYHWRWKH&LW\¶VQHHGV7KDQN\RXDJDLQIRUWKHRSSRUWXQLW\WRFRQWLQXLQJWRZRUNZLWKWKH
&LW\RI(GHQ3UDLULH
$WWDFKHGLVRXUSURSRVHGVFRSHRIVHUYLFHVVFKHGXOHDQGFRVWHVWLPDWHWRFRPSOHWH3KDVH
2QEHKDOIRI6WDQWHFWKDQN\RXIRUWKLVRSSRUWXQLW\WRFRQWLQXHWRVHUYHWKH&LW\RI(GHQ3UDLULH,IWKHUHDUH
DQ\TXHVWLRQVUHODWHGWRWKLVSURSRVDOGRQ¶WKHVLWDWHWRFDOORUHPDLO
-RVKXD$FFROD#VWDQWHFFRP
6LQFHUHO\
-RVK$FFRODPE,MS,CFM
WaterResourcesEngineer
Phone:(715)207-5157
Joshua.Accola@stantec.com
Attachments:Phase11Scopeofservices
(;+,%,7$
6WDQWHF&RQVXOWLQJ6HUYLFHV,QF
2QH&DUOVRQ3DUNZD\1RUWK
3O\PRXWK01
3URMHFW8QGHUVWDQGLQJDQG$VVXPSWLRQV
352-(&781'(567$1',1*
6WDQWHFXQGHUVWDQGVWKH3KDVH%DVLQ,QYHQWRU\DQG0DLQWHQDQFH$VVHVVPHQWLQFOXGHVVXEZDWHUVKHGV
FRQWULEXWLQJWR$QGHUVRQ/DNHV)LJXUHVKRZVWKHVXUYH\DUHDDORQJZLWKWKHEDVLQVWREHVXUYH\HG
3UHYLRXVO\6WDQWHFKDVZRUNHGZLWKWKH&LW\RI(GHQ3UDLULHRQQLQHSUHYLRXVSKDVHVRIWKH%DVLQ,QYHQWRU\
DQG0DLQWHQDQFH$VVHVVPHQW7KHSKDVHVLQFOXGH
•6WDULQJ/DNH 3KDVH,
•5HG5RFN/DNHDQG'XFN/DNH 3KDVH,,
•(GHQ/DNHDQG1HLOO/DNH 3KDVH,,,
•/RZHU5LOH\&UHHN 3KDVH,9
•0LWFKHOO/DNH 3KDVH9
•/DNH5LOH\DQG5LFH0DUVK/DNH 3KDVH9,
•5RXQG/DNH 9,,
•/DNH6PHWDQD 9,,,
•%LUFK,VODQG/DNHDQG:HVW%U\DQW/DNH ,9
•(DVW%U\DQW/DNH ;
7KHSURSRVHGWHQWKSKDVHRIWKHSURMHFWZLOOIROORZDVLPLODUDSSURDFKWRWKHSUHYLRXV3KDVHV
6WDQWHF&RQVXOWLQJ6HUYLFHV,QF
2QH&DUOVRQ3DUNZD\1RUWK
3O\PRXWK01
$668037,216
6WDQWHFDVVXPHVWKHIROORZLQJIRUWKLVSURMHFW
•2QH 6WDQWHFWHDPPHPEHUZLOOFRQGXFWWKHEDWK\PHWULFILHOGVXUYH\VDQGGRFXPHQWLQJ
PDLQWHQDQFHQHHGVXVLQJWKH&LW\¶VLQVSHFWLRQIRUPV
•7KH6WDQWHFVWDIIZLOOEHDFFRPSDQLHGE\WKH&LW\¶VZDWHUUHVRXUFHVLQWHUQ V :HGLGDVVXPH
GD\VIRUDVHFRQG6WDQWHFWHDPPHPEHUIRUILHOGZRUNLIWKHLQWHUQ V KDYHHQGHGWKHLUWHUPDQG
DGGLWLRQDOILHOGZRUNLVQHHGHG
•6WDQWHFZLOOXWLOL]HWKH&LW\¶V06LQVSHFWLRQILHOGDSSOLFDWLRQDQG6XUYH\IRUPV6WDQWHFZLOO
REWDLQDFFHVVWREHDEOHWRORJLQWRWKH&LW\¶VZHEPDSWRDFFHVVWKHIRUPV
o)ROORZLQJILHOGVXUYH\V6WDQWHFZLOOREWDLQUHFRUGVFROOHFWHGGXULQJILHOGVXUYH\VWRFUHDWHD
PDLQWHQDQFHSULRULW\OLVW
•6WDQWHFZLOOUHTXHVWDVEXLOWGRFXPHQWVIURPWKH&LW\DQGSHUIRUPFDOFXODWLRQVRQWKHGHVLJQRUDV
EXLOWFRQGLWLRQV7KH&LW\ZLOOSURYLGHWKHQHFHVVDU\GUDZLQJVWR6WDQWHFIRUWKHEDVLQDQDO\VLVWDVN
o6WDQWHFZLOOWUDQVFULEHLQIRUPDWLRQIURPWKHDVEXLOWVDQGSHUIRUPFDOFXODWLRQV RULJLQDODV
EXLOWYROXPHVDQGIORRGYROXPHV WRLQFOXGHLQWKHPDVWHULQYHQWRU\GDWDEDVH,QSUHYLRXV
LQYHQWRU\SKDVHVD&LW\LQWHUQKDVFRPSOHWHGWKLVWDVN
•6WDQWHFZLOOUHFHLYHWKHPRVWFXUUHQW*,6ILOHVSULRUWRVWDUWLQJWKHILHOGVXUYH\VWRGHWHUPLQHLIQHZ
EDVLQVZHUHDGGHG
•6WDQWHFZLOOXWLOL]HDQH[LVWLQJUHSRUWWHPSODWHGHYHORSHGIRUWKH(DVW%U\DQW/DNH%LUFK,VODQG
/DNH/DNH6PHWDQD5RXQG/DNHDQG/DNH5LOH\UHSRUWV
•6WDQWHFZLOOGHYHORSD3PRGHOEDVHGRQWKHGDWDFROOHFWHG
6WDQWHF&RQVXOWLQJ6HUYLFHV,QF
2QH&DUOVRQ3DUNZD\1RUWK
3O\PRXWK01
6FRSHRI6HUYLFHV
7KHVFRSHRIVHUYLFHVIRUWKH3KDVH%DVLQ,QYHQWRU\DQG0DLQWHQDQFH$VVHVVPHQWLQFOXGH
•7DVN±6WRUPZDWHU6\VWHP$QDO\VLV
•7DVN±6HGLPHQW6XUYH\
•7DVN±%DVLQ$QDO\VLV
•7DVN±5HSRUWLQJ5HTXLUHPHQWV
•7DVN±0HHWLQJV 3URMHFW0DQDJHPHQW
7$6.±67250:$7(56<67(0$1$/<6,6
7KLVWDVNFRQVLVWVRILGHQWLI\LQJWKHEDVLQVWKH&LW\LVUHVSRQVLEOHIRUPDLQWDLQLQJVHOHFWLQJEDVLQVIRU
IXUWKHUILHOGHYDOXDWLRQDQGGHOLQHDWLQJWKHVXEZDWHUVKHGIRUHDFKEDVLQ 7KURXJKRXWWKLVSURSRVDOZHZLOO
UHIHUWRFRQVWUXFWHGVWRUPZDWHUSRQGVDQGVWRUPZDWHUZHWODQGVFROOHFWLYHO\DV³EDVLQV´ %DVLQ
LGHQWLILFDWLRQZLOOEHFRRUGLQDWHGZLWK&LW\VWDIIWRGHWHUPLQHZKLFKEDVLQVDUHORFDWHGRQ&LW\SURSHUW\
ZLWKLQ&LW\ULJKWRIZD\RUXQGHUDGUDLQDJHDQGXWLOLW\HDVHPHQW:HH[SHFWWRORFDWHEDVLQVRQ&LW\
SURSHUW\DQGZLWKLQ&LW\ULJKWRIZD\XVLQJ*,6EDVHGSDUFHOLQIRUPDWLRQIURPWKH&LW\:HZLOOFRQWLQXH
FROODERUDWLQJZLWK&LW\VWDIILQGHWHUPLQLQJZKLFKEDVLQVPD\EHXQGHUGUDLQDJHDQGXWLOLW\HDVHPHQWV7KH
VXEZDWHUVKHGVIRUHDFKEDVLQZLOOEHGHOLQHDWHGXVLQJ/L'$5FRQWRXUVDQGVWRUPVHZHULQIRUPDWLRQ
7KHUHDSSHDUVWREHSXEOLFEDVLQVLQWKH$QGHUVRQ/DNHVZDWHUVKHG)LJXUH DWWDFKHG SURYLGHVDQ
RYHUYLHZRIZDWHUVKHGGLYLVLRQVDQGSURSRVHGEDVLQVWRVXUYH\ZLWKLQHDFKGUDLQDJHDUHD7KHQXPEHUDQG
RZQHUVKLSRIEDVLQVZLOOEHYHULILHGSULRUWRILHOGHYDOXDWLRQV7KLVSURSRVDOHIIRUWDVVXPHVDOORIWKHEDVLQV
ZLOOEHLQFOXGHGLQWKHLQYHQWRU\
7KHEUHDNGRZQRIWKHVHEDVLQVDUHEHORZ
•&RQVWUXFWHG3RQGV
•,QILOWUDWLRQ%DVLQV
•6WRUPZDWHU0LWLJDWLRQ:HWODQGV D
•:HWODQGV
7DVN'HOLYHUDEOH
•6SUHDGVKHHWRUGDWDEDVHOLVWLQJWKHZDWHUERGLHVVWRUPZDWHUEDVLQVLGHQWLILHGIRULQFOXVLRQLQWKH
SURMHFW
•:DWHUVKHGGHOLQHDWLRQVRILQGLYLGXDOEDVLQV
7$6.±),(/'6859(<6
)RU7DVN6WDQWHFZLOOYLVXDOO\LQVSHFWDQGSHUIRUPDEDWK\PHWULFVXUYH\IRUHDFKEDVLQLGHQWLILHGLQ
7DVN7KHLQVSHFWLRQDQGVXUYH\IRUEDVLQVLQWKH$QGHUVRQ/DNHVZDWHUVKHGZLOOEHFRQGXFWHGLQ
VXPPHUDQGIDOORI7KHLQVSHFWLRQDQGVXUYH\LQIRUPDWLRQZLOOEHXVHGWRGHWHUPLQHLIPDLQWHQDQFHLV
UHTXLUHGDQGDVVHVVWKHEDVLQSROOXWDQWUHPRYDOSHUIRUPDQFH 7DVN
April4,2024
LoriHaakPage5of8
Reference:Phase11BasinInventoryandAssessment
6WDQWHFZLOOUHYLHZRUFROOHFWWKHIROORZLQJIRUHDFKEDVLQYLVXDOLQVSHFWLRQ
•5HYLHZVWRUPVHZHUJUDGLQJDQGXWLOLW\SODQVDYDLODEOHIRUHDFKEDVLQSULRUWRILHOGHYDOXDWLRQ,I
SRVVLEOHWKHVHSODQVZLOOEHWDNHQLQWRWKHILHOGZLWKWKHLQVSHFWRUWRDOORZIRUHDV\FRPSDULVRQ
EHWZHHQWKHSURSRVHGDQGFRQVWUXFWHGIDFLOLWLHV
•3KRWRJUDSKEDVLQIHDWXUHV
•,GHQWLI\DQGUHSRUWSODLQVLJKWPDLQWHQDQFHQHHGV LHHURVLRQDFFXPXODWLRQRIGHEULVRQWUDVK
UDFNVUHSDLUVWRGDPDJHGVWUXFWXUHV XVLQJWKH³6WRUPZDWHU6\VWHP)ROORZ8S&KHFNOLVW´
6WDQWHFZLOOFRQGXFWWKHVHGLPHQWDWLRQVXUYH\XVLQJ*36VXUYH\HTXLSPHQW7KHHOHYDWLRQVIRULQOHWVDQG
RXWOHWVZDWHUVXUIDFHHOHYDWLRQDQGJURXQGVKRWVDERYHWKHZDWHUVXUIDFHHOHYDWLRQVXUURXQGLQJWKHSRQG
ZLOOEHVXUYH\HGXVLQJVXEFHQWLPHWHUJUDGH*36VXUYH\HTXLSPHQW7KHSHUPDQHQWSRRORIWKHEDVLQZLOO
EHVXUYH\HGE\PHDVXULQJWKHGHSWKRIZDWHUDWHDFKPHDVXULQJORFDWLRQDQGWKHQWKHHOHYDWLRQZLOOEH
GHWHUPLQHGE\VXEWUDFWLQJWKHGHSWKIURPWKHZDWHUVXUIDFHHOHYDWLRQ7KHVHGLPHQWDFFXPXODWLRQZLOOEH
PHDVXUHGDWHDFKORFDWLRQE\DGYDQFLQJDURGLQWRWKHVHGLPHQWXQWLOWKHGHSWKRIUHIXVDO WKHRULJLQDOEDVLQ
ERWWRP (DFKORFDWLRQRIPHDVXUHPHQWZLOOEHVXUYH\HGZLWKVXEPHWHUJUDGH*36VXUYH\HTXLSPHQW
([SHQVHVIRUWKLVWDVNLQFOXGHPLOHDJHWKH*36HTXLSPHQWDQGWKHERDW
7DVN'HOLYHUDEOHV
•&ROOHFWEDWK\PHWULFGDWDRIVWRUPZDWHUSRQGVDQGZHWODQGV
•0DQDJHVXUYH\GDWDLQD*,6HQYLURQPHQW
•'RFXPHQWPDLQWHQDQFHFRQFHUQVXVLQJWKH&LW\¶VLQVSHFWLRQIRUPV
7$6.±%$6,1$1$/<6,6
7DVNDQDO\]HVWKHGDWDFROOHFWHGIURP7DVNWRGHWHUPLQHWKHVHGLPHQWDWLRQOHYHOSROOXWDQWUHPRYDO
HIIHFWLYHQHVVRIWKHEDVLQDQGXOWLPDWHO\ZKLFKEDVLQVQHHGVHGLPHQWUHPRYDO7KHEDVLQDQDO\VLVIRU
3KDVHZLOOEHFRQGXFWHGLQWKHIDOORIDQGFRQWLQXHWKURXJKWKHVSULQJRI
6WDQWHFZLOOXVH(65,VRIWZDUHWRLPSRUWWKH*36VXUYH\GDWDIURPWKHILHOGHYDOXDWLRQWRGHWHUPLQHWKH
GHJUHHRIVHGLPHQWGHSRVLWLRQLQHDFKEDVLQ7KH$UF*,6VRIWZDUHZLOODOORZ6WDQWHFWRFDOFXODWHWKH
YROXPHRIWKHEDVLQEHORZDQ\HOHYDWLRQ7KHUHIRUHZHFDQTXLFNO\FDOFXODWHWKHEDVLQVXUIDFHDUHD
SHUPDQHQWSRROYROXPHDQGOLYHVWRUDJHYROXPH)URPWKLVLQIRUPDWLRQZHZLOOWKHQHVWLPDWHWKHGHJUHH
RIVHGLPHQWDWLRQE\FRPSDULQJWKHYROXPHWRWKHGHVLJQRUDVEXLOWSODQVIRUHDFKEDVLQ:KHUHGHVLJQRU
DVEXLOWSODQVDUHQRWDYDLODEOHZHZLOOGHWHUPLQHWKHGHJUHHRIVHGLPHQWDWLRQXVLQJWKHSURELQJURGUHVXOWV
8VLQJWKHVSUHDGVKHHWIURP7DVN6WDQWHFZLOOFDOFXODWHWKHZDWHUTXDOLW\YROXPHGUDLQLQJWRWKHEDVLQ
DQGWKHSHUPDQHQWSRROYROXPHZLWKLQWKHEDVLQ)ORRGHOHYDWLRQVZLOOEHREWDLQHGIURPGHVLJQSODQVRU
HVWLPDWHGXVLQJWKHWRSHOHYDWLRQRIWKHEDVLQ
6WDQWHFZLOOSULRULWL]HEDVLQPDLQWHQDQFHDQGH[SDQVLRQSURMHFWVEDVHGRQWKHGHJUHHRIVHGLPHQWDWLRQ
IRXQGLQHDFKSRQGLWVK\GURORJLFSUR[LPLW\WRSXEOLFZDWHUVDQGWKHSRWHQWLDOZDWHUTXDOLW\EHQHILWVRI
LQFUHDVLQJSHUPDQHQWSRROYROXPHV7KHSODLQVLJKWPDLQWHQDQFHQHHGVLGHQWLILHGGXULQJWKHILHOG
April4,2024
LoriHaakPage6of8
Reference:Phase11BasinInventoryandAssessment
HYDOXDWLRQZLOOEHLQFOXGHGLQDVHSDUDWHSULRULWL]DWLRQWKDWWKHFLW\PD\ZLVKWRHYDOXDWHRQDFDVHE\FDVH
EDVLVDQGLQFRUSRUDWHWKHPLQWRRQJRLQJPDLQWHQDQFHSURJUDPV
6WDQWHFZLOOGHYHORSD3PRGHOEDVHGRQWKHUHVXOWVIURP7DVN7KHPRGHOOLQJUHVXOWVZLOOEH
LQFRUSRUDWHGLQWRWKHUHSRUWDQGZLOOEHXVHGWRSULRULWL]HEDVLQLPSURYHPHQWSURMHFWV
7DVN'HOLYHUDEOHV
•([SDQGWKHVSUHDGVKHHWRUGDWDEDVHIURP7DVNWRLQFOXGHWKHFDOFXODWHGSDUDPHWHUVIURP7DVN
•'HYHORSD3PRGHO
•3UHSDUHPHPRRIUHVXOWVRI3PRGHOLQJ
7$6.±5(3257,1*5(48,5(0(176
8SRQFRPSOHWLRQRIWKHDQDO\VLV6WDQWHFZLOOFRPSOHWHDUHSRUWWRVXPPDUL]HWKHPHWKRGVDQGUHVXOWV7KH
UHSRUWZLOOGHWDLOWKHPHWKRGVRIWKHILHOGHYDOXDWLRQDQGDQDO\VLVIURP7DVNVDQGKLJKOLJKWFULWLFDO
PDLQWHQDQFHDFWLYLWLHVLQFOXGLQJLQGLYLGXDOEDVLQVHGLPHQWYROXPHV3ODLQVLJKWPDLQWHQDQFHDFWLYLWLHVZLOO
EHVXPPDUL]HGXVLQJWDEOHVDQGILJXUHVUDWKHUWKDQDGHWDLOHGH[SODQDWLRQIRUHDFKLQGLYLGXDOEDVLQYLVLWHG
GXULQJWKHILHOGHYDOXDWLRQ
7KHWHFKQLFDOPHPRUDQGXPZLOOSUHVHQWFRVWFRQVLGHUDWLRQVIRUWKHUHFRPPHQGHGPDLQWHQDQFHDFWLYLWLHV
$PRQJWKHVHGUHGJLQJDQGGLVSRVDORIVHGLPHQWLVOLNHO\WKHPRVWFRVWO\7KHFRVWHVWLPDWHVLQFOXGH
FRQVWUXFWLRQFRVWV LQFOXGLQJPRELOL]DWLRQVLWHSUHSDUDWLRQVHGLPHQWH[FDYDWLRQDQGGLVSRVDOPLQRUVWRUP
VHZHURUVWUXFWXUDOZRUNDQGHURVLRQFRQWURO /DERUDWRU\DQDO\VLVDQGUHVXOWVDQDO\VLV/HYHOVHGLPHQW
GLVSRVDOFRVWVDFFRUGLQJWRWKH03&$JXLGDQFH(QJLQHHULQJFRVWVDQGFRQWLQJHQF\
6WDQWHFZLOOVXEPLWDGUDIWWHFKQLFDOUHSRUWWR&LW\VWDIIIRUUHYLHZDQGDSSURYDOSULRUWRILQDOL]LQJWKHUHSRUW
:HH[SHFWRQHPHHWLQJZLWK&LW\VWDIIWRSUHVHQWWKHUHVXOWVDQGUHFRPPHQGDWLRQVRIWKHVWXG\
7DVN'HOLYHUDEOHV
•)LQDOVSUHDGVKHHWRUGDWDEDVHLQFOXGLQJHYDOXDWHGLQIRUPDWLRQIRUHDFKEDVLQ
•$OO*,6ILOHV
•)LQDOUHSRUWRIVXUYH\UHVXOWVPDLQWHQDQFHUHFRPPHQGDWLRQVDQGZDWHUTXDOLW\LPSURYHPHQW
RSSRUWXQLWLHV
7$6.±0((7,1*6 352-(&70$1$*(0(17
7DVNLQFOXGHVDWWHQGDQFHDWSURMHFWNLFNRIIPHHWLQJDQGSURMHFWFRRUGLQDWLRQWLPH7KLVWDVNDOVR
LQFOXGHSURMHFWPDQDJHPHQWDFWLYLWLHVIRUPRQWKO\LQYRLFLQJ
7DVN'HOLYHUDEOHV
•$WWHQGDQFHDWPHHWLQJWRNLFNRIIWKHSURMHFWDQGGLVFXVVZKLFKSRQGVZLOOEHLQFOXGHGLQWKHILHOG
VXUYH\
April4,2024
LoriHaakPage7of8
Reference:Phase11BasinInventoryandAssessment
6FKHGXOHDQG&RVW
6WDQWHFDQWLFLSDWHVWKHSURMHFWZLOOVWDUWDIWHUDVLJQHGFRQWUDFWIROORZLQJWKH$SULOWK&LW\&RXQFLOPHHWLQJ
$IWHUUHFHLYLQJDVLJQHGDJUHHPHQW6WDQWHFZLOOKROGDSURMHFWNLFNRIIDQGWDVNVHWWLQJPHHWLQJZLWKWKH&LW\
GXULQJWKHZHHNIROORZLQJFRXQFLODSSURYDO7DEOHLGHQWLILHVWKHJHQHUDOSURMHFWWDVNVDQGWKHSURSRVHG
WLPLQJRIWKHWDVNVDVVXPLQJDVLJQHGDJUHHPHQWLVUHFHLYHGE\WKHHQGRI$SULO
6WDQWHFZLOOSHUIRUPWKHVFRSHRIZRUNRXWOLQHGDERYHRQDWLPHDQGPDWHULDOVEDVLVQRWWRH[FHHG
6WDQWHFZLOOQRWH[FHHGWKHDPRXQWLQWKLVFRQWUDFWZLWKRXWZULWWHQFRQVHQWIURPWKH&LW\,QWKHHYHQWRIRXW
RIVFRSHZRUNRUDGGLWLRQDOUHTXHVWVIURPWKH&LW\6WDQWHFZLOOZRUNZLWKWKH&LW\WRGHYHORSDFKDQJHLQ
VFRSHDQGDGGLWLRQDOEXGJHWQHHGHGWRFRPSOHWHWKHWDVN V 7DEOHRXWOLQHVWKHH[SHFWHGODERUFRVWV
UHLPEXUVDEOHH[SHQVHVDQGHTXLSPHQWWKDWZLOOEHXWLOL]HGIRUWKLVSURMHFW
7DEOH&RVWDQG6FKHGXOHIRU3KDVH,QYHQWRU\
7DVN
1XPEHU
7DVN1DPH6WDUW
'DWH
(QG'DWH/DERU
&RVW
([SHQVH
V
7RWDO
6WRUPZDWHU
6\VWHP$QDO\VLV
6HGLPHQWDWLRQ
6XUYH\
%DVLQ$QDO\VLV
5HSRUWLQJ
3URMHFW
0DQDJHPHQW
7RWDO
7KDQN<RX
6WDQWHFDSSUHFLDWHVWKHRSSRUWXQLW\WRSUHVHQWWKLVVFRSHRIZRUNWRWKH&LW\RI(GHQ3UDLULH6WDQWHFLV
FRPPLWWHGWRGHOLYHULQJWKHSURSRVHGVFRSHRIVHUYLFHVRQWLPHDQGZLWKLQEXGJHW6KRXOG\RXKDYH
TXHVWLRQRQLWHPVSUHVHQWHGLQWKLVSURSRVDOSOHDVHGRQRWKHVLWDWHWRFDOORUHPDLO5HJDUGV
6WDQWHF&RQVXOWLQJ6HUYLFHV,QF
-RVKXD$FFRODPE,CFM
:DWHU5HVRXUFHV(QJLQHHU
3KRQH
-RVKXDDFFROD#VWDQWHFFRP
April4,2024
LoriHaakPage8of8
Reference:Phase11BasinInventoryandAssessment
,I&LW\RI(GHQ3UDLULH01DJUHHVZLWKWKLVSURSRVDO&LW\RI(GHQ3UDLULH01VKDOODXWKRUL]H6WDQWHFWR
SHUIRUPWKHZRUN
Attachment:Figure1:BasinsincludedinPhase11
CarverCounty
DakotaCounty
HennepinCounty
Ramsey
County
ScottCounty
13-24-B
13-23-A
13-24-A
13-34-B
13-14-B
24-44-A
24-42-A
24-41-B
24-41-A
24-24-C
24-24-B
24-24-A24-22-C
24-22-B
24-22-A
24-21-B
24-21-A
13-34-A-m
13-33-A
13-32-A
13-13-C
13-13-B
13-13-A
13-11-C13-11-B
Disclaimer: This document has been prepared based on information provided by others as cited in the Notes section. Stantec has not verified the accuracy and/or completeness of this information and shall not be responsible for any errors or omissions which may be incorporated herein as a result. Stantec assumesno responsibility for data supplied in electronic format, and the recipient accepts full responsibility for verifying the accuracy and completeness of the data.
Client/Project
Figure No.
Project Location
Title
k
V:\2277\active\227706102\03_data\gis_cad\gis\pro\phase_x\phase_x.aprx Revised: 2024-03-12 By: ahyamsLegend
Constructed Ponds
Infiltration BMPs
Mitigation Wetlands
Stormwater Wetlands
Wetlands
Watershed
Anderson Lakes
Page 1 of 1
Notes1. Coordinate System: NAD 1983 HARN Adj MN Hennepin Feet2. Data Sources: City of Eden Prairie - Stormwater Basins3. Background: Open Street Map
(At original document size of 11x17)1:12,000
0 500 1,000Feet
Prepared by ARH on 2024-03-12Eden Prairie, Hennepin Co., MN
City of Eden PrairieAnderson Lakes Inventory & Assessment
Basins Included in Phase XI
1
CITY COUNCIL AGENDA
SECTION: Consent Calendar
DATE:
May 7, 2024
DEPARTMENT/DIVISION:
Patrick Sejkora
Public Works / Engineering
ITEM DESCRIPTION:
Approve License Agreement with Riley Purgatory Bluff Creek Watershed District Hydrologic and Hydraulic Model for Riley Creek
ITEM NO.:
VIII.L.
Requested Action
Move to: Approve License Agreement with Riley Purgatory Bluff Creek Watershed District Hydrologic and Hydraulic Model for Riley Creek Synopsis
The License Agreement with Riley Purgatory Bluff Creek Watershed District (RPBCWD) Hydrologic and Hydraulic Model for Riley Creek would permit the City and consulting firms working on behalf of the City, to use the RPBCWD PCSWMM model for the design and permitting of various public works projects. Background Information The City has the Dell Road public improvements project that needs to utilize the RPBCWD hydrologic and hydraulic model for Riley Creek. The RPBCWD hydrologic and hydraulic model will assist in evaluating the hydraulic impacts of design alternatives and in permitting these projects and future
public works projects. Attachment License Agreement for Riley Purgatory Bluff Creek Watershed District Hydrologic and Hydraulic
Model
1
LICENSE AGREEMENT RILEY PURGATORY BLUFF CREEK WATERSHED DISTRICT STORMWATER HYDRAULIC MODEL Licensee: City of Eden Prairie THIS LICENSE AGREEMENT is entered into by the Riley Purgatory Bluff Creek Watershed District (District), a political subdivision of the State of Minnesota, and the City of Eden Prairie (City), a public corporation and political subdivision of the State of Minnesota (User). WHEREAS the District has developed a stormwater hydraulic model that may be used to generate stormwater flow volume and rate information, flood elevations, floodplain delineations and related data; WHEREAS the stormwater hydrologic and hydraulic model has been developed for application
to watershed-wide planning as well as to the evaluation of local consequences of development or public infrastructure projects; WHEREAS the stormwater model has been developed with public resources, and it is the District’s intent that it be made available for use by other public bodies and the public
generally to provide the greatest public benefit for purposes of water resource planning, management and protection; WHEREAS the District finds that wide usage of the stormwater hydrologic and hydraulic
model within the watershed has watershed-wide benefit, wishes to promote such use, and therefore has determined not to charge User to use the PC-SWMM model and underlying data for the Riley Creek Watershed (the Model);
WHEREAS the District has determined that the Model is classified as nonpublic trade secret
information and otherwise data not subject to disclosure under the Minnesota Data Practices Act, Minnesota Statutes chapter 13. The District has decided to provide for the disclosure of the Model in accordance with certain protections and commitments by User as set forth in this License Agreement; NOW THEREFORE, in consideration of the foregoing, the District and User agree as follows: 1. Use of the Model
1.1 Authorized Use. User is granted a nonexclusive, nontransferable and nonassignable (except
as provided herein) license to use the Model exclusively for the purposes of work directly related to public-infrastructure improvement projects. This license will be in effect only during
2
compliance by User and its agents, consultants and contractors (ACCs) with the terms and conditions of this License Agreement. User and, pursuant to section 1.3, its ACCs may use the Model in the form provided by the District for the authorized Project purpose and for no other
purpose. User and its ACCs may modify or transfer the Model, or merge the Model into other databases or applications only for User’s authorized Project purposes. User and its ACCs may operate on the Model using such proprietary or public software as they are independently authorized to use and may disclose or distribute the products of that operation, but may not
disclose or distribute the Model in the same or substantially the same form as received from the
District. User may duplicate the Model for use by User and its ACCs, provided the computer central processing units on which the Model is maintained support only equipment operated by User and its ACCs, and the Model is used only for User’s authorized purpose. Except for off-site
backup pursuant to established procedures, User and its ACCs will not remove the Model from their places of business. 1.2 Unauthorized Uses. User and its ACCs may not use the Model on behalf of any individual,
organization, corporation, government entity, or any other party except as authorized herein. User’s ACCs will use the Model only in the conduct of User’s business and for User’s authorized purpose. User and its ACCs will not duplicate or disclose the Model to any third parties unless such use, duplication or disclosure is expressly authorized in writing by the
District. User and its ACCs will not charge third parties for the availability of the Model. This will not prevent User and its ACCs from charging third parties as otherwise authorized for its staff time, work products or ancillary costs associated with modeling and analysis using the Model. User acknowledges that the District has declared the applicability of copyright protection to the Model. User will conform to all legal requirements related to the copyrighted status of the data as declared by the District. 1.3 Third-Party Access. If it is necessary for User to make the Model available to an outside ACC for User’s authorized purposes, User must obtain from each ACC and provide to the District a signed copy of the Model License Agreement Third-Party Certification attached to and incorporated into this License Agreement as Attachment A, and must receive written authorization from the District. Under the Third-Party Certification, ACCs are subject to all
terms and obligations of this License Agreement to the same extent as the terms and obligations apply to User. 1.4 Data Security. User and its ACCs agree to take all necessary and reasonable steps to
ensure the Model is not disclosed or made accessible in whole or part to third parties except as
authorized in or pursuant to this License Agreement. User and its ACCs agree they will not knowingly or negligently allow their employees or agents to copy, sell, disclose or otherwise make the Model available to others. User and its ACCs agree to immediately notify the District by telephone and in writing of any unauthorized sale or other disclosure. User and its ACCs
further agree to prevent unauthorized disclosure through appropriate security measures
3
including, but not limited to, providing physical and electronic security for copies of the Model
and taking all steps that they take to protect tangible and intangible data products of their own that they regard as proprietary, confidential or nonpublic. 1.5 Data Practices Act. User will treat the Model as nonpublic data not subject to public
disclosure under the Minnesota Data Practices Act and will advise any requestor of the data
classification accordingly. User will notify the District immediately of any challenge to User’s withholding of the Model and will not release the Model, or any part thereof, pursuant to the Data Practices Act without written authorization from the District.
1.6 Reservation of Rights. The Model is the exclusive property of the District, which retains all right, title and interest in the Model, including the right to license the Model to other users. Any right or remedy provided to the District in this License Agreement is nonexclusive and in addition to any other right or remedy available to the District in law or equity. 1.7 Errors and Omissions. User timely will advise the District in writing of any errors or omissions it finds within the Model. This includes but is not limited to advising the District of new or omitted data of which User or its ACCs are aware, as well as of changes to the physical environment at a scale that would be recognized by the Model. 2. License Agreement Term and Termination 2.1 Term. The License Agreement is effective on execution by both parties and remains
effective until the January 31 first following commencement. Notwithstanding, the License Agreement will renew automatically from year to year unless terminated as provided herein. However, the District assumes no duty to any User or ACC to update the Model and it remains the sole and absolute responsibility of User and its ACCs to ensure that the Model is current,
accurate and adequate for their use and purposes. 2.2 Termination. The District may terminate this License Agreement at any time on written notice to User if User or one or more of its ACCs fails to comply with the terms and conditions of this License Agreement. The District also may independently revoke approval of one or more
ACC and the associated Third-Party Certification(s) without necessarily terminating the License Agreement. The District or User may terminate the License Agreement without cause on 30-day notice to the other party. 2.3 Return or Destruction of Model. When this License Agreement has been terminated, User
must either destroy all copies of the Model and provide to the District written certification of the
destruction, or return all copies of the Model to the District. 3. Limited Warranty and Disclaimers
3.1 Limited Warranty. The Model is provided by the District to User subject to the following
limitations and restrictions:
4
(a) User is responsible for the installation and use of the Model and the results or consequences resulting from User’s installation or use of the Model. (b) The District does not warrant that the Model is error free, and disclaims any other warranties, express or implied, respecting this License Agreement or the Model. (c) THE MODEL IS PROVIDED “AS IS” WITHOUT ANY SUPPORT WHATSOEVER
AND WITHOUT WARRANTY AS TO ITS PERFORMANCE, MERCHANTABILITY OR FITNESS FOR ANY PARTICULAR PURPOSE. THE ENTIRE RISK AS TO THE RESULTS AND PERFORMANCE OF THE MODEL IS ASSUMED BY USER.
(d) THE DISTRICT WILL NOT BE LIABLE TO USER FOR ANY INDIRECT, SPECIAL, INCIDENTAL, COMPENSATORY OR CONSEQUENTIAL DAMAGES, LOSS OF PROFIT, OTHER FINANCIAL LOSS, LOSS OF DATA, OR ANY OTHER DAMAGE OF ANY KIND ARISING OUT OF USER’S USE OR ATTEMPTED USE OF THE MODEL, OR ANY THIRD-PARTY CLAIMS THAT
MAY RESULT FROM THE USE OF THE MODEL, EVEN IF THE DISTRICT HAS BEEN ADVISED OF THE POSSIBILITY OF SUCH POTENTIAL LOSS OR DAMAGE. 3.2 Sole Remedies. User’s sole and exclusive remedies for breach of these limited warranties
will be as follows: (a) User may return the Model to the District, which, at its discretion, may replace or repair the Model and return the Model to User; or (b) User may terminate this License Agreement in accordance with section 2, above. 3.3 Indemnification. Without waiving any statutory immunities and specifically subject to the
liability limits contained in Minn. Stat. chapter 466.04, User will hold harmless, defend and indemnify the District, its officers, board members, employees and agents from any and all actions, costs, damages and liabilities of any nature related to User’s negligent use of the Model,
to the extent permitted by law. Nothing in this License Agreement will be construed to waive any immunity, defense or limit on liability applicable to the District or User, or otherwise to create any right in User other than the remedies of section 3.2, or any right in any third party.
4. General Terms and Conditions 4.1 Whereas Clauses. All recitals included in this License Agreement are incorporated into and
considered a part of the License Agreement. 4.2 Amendment. The terms of this License Agreement may be amended only by written agreement of the District and User.
4.3 Governing Law. This License Agreement will be governed by and interpreted according to
the laws of the State of Minnesota. 4.4 Waiver. No waiver of any violation of this License Agreement will constitute a waiver of
5
any subsequent violation, whether of the same or of any other term. Subsequent performance of any of the terms of this License Agreement will not constitute a waiver of any preceding
violation, regardless of the other party’s knowledge of the preceding violation at the time of subsequent performance. The delay or omission of any party’s exercise of any right arising from any default will not affect or impair the party’s rights regarding the same or future default. 4.5 No Agency. The District and User are independent parties for all legal purposes hereunder, and nothing herein will be construed to create an agency, joint venture, partnership or other form of business association between the parties. 4.6 Assignment. User will not assign or transfer this License Agreement in whole or in part,
without the prior written consent of the District. Any attempt to assign or transfer this License Agreement without prior written consent will be void and of no force or effect. 4.7 Correspondence. Correspondence regarding this License Agreement or the Model will be directed as follows:
To the
District:
Administrator Riley Purgatory Bluff Creek Watershed District 18681 Lake Drive East Chanhassen, MN 55317 To User:
Patrick Sejkora, PE, CFM Water Resources Engineer City of Eden Prairie 8080 Mitchell Road
Eden Prairie, MN 55344
4.8 Survival of Provisions. All obligations of User regarding use and protection of the Model; all obligations to hold harmless, defend and indemnify; and limitations on and disclaimers of all
warranties in this License Agreement will survive termination of the Agreement. 4.9 Authority. The person or persons executing this License Agreement on behalf of User represent that they are duly authorized to execute this License Agreement on behalf of User and
represent and warrant that this License Agreement is a legal, valid and binding obligation enforceable according to its terms.
6
INTENDING TO BE LEGALLY BOUND by the foregoing terms:
_____________________ Date:
Rick Getschow
City Manager
___________________ Date:
Ron Case
Mayor
RILEY PURGATORY BLUFF CREEK WATERSHED DISTRICT Terry Jeffery,
Administrator
Date:
7
ATTACHMENT A MODEL LICENSE AGREEMENT THIRD-PARTY CERTIFICATION
______________________________________________ hereby requests authority to exercise
rights to use the Riley Purgatory Bluff Creek Watershed District’s Purgatory Creek subwatershed model (the Model) as an agent, consultant or contractor to City of Eden Prairie under the License Agreement executed on _______________________________ between City Eden Prairie and the Riley Purgatory Bluff Creek Watershed District. In assuming that authority, and in consideration
therefore, hereby represents and affirms that it has received and is familiar with the cited License
Agreement, that its authority is limited by the terms of the Agreement, and that it is fully subject to all limitations, obligations and liabilities set forth in that Agreement to the same extent as if it were a signatory thereto. [NAME of ENTITY]
By Print name: Print title:
(Notary Acknowledgment)
Date:
CITY COUNCIL AGENDA
SECTION: Consent Calendar
DATE:
May 7, 2024
DEPARTMENT/DIVISION:
Robert Ellis
Public Works
ITEM DESCRIPTION:
Approve Institution Community Work Crew Agreement for 2024 thru 2026
IEM NO.:
VIII.M.
Requested Action
Move to: Approve Institution Community Work Crew Agreement for 2024 thru 2026. Synopsis Annual agreement for labor assistance provided by the Minnesota Department of Corrections
through the Institution Community Work Crew (ICWC) program from July 1, 2024 through June 30, 2026 at a cost of $106,750 per year. The types of tasks ICWC members perform are related to street, park and utility maintenance. Background Information
Each year, the city relies on labor assistance provided by the Minnesota Department of Corrections through the Institution Community Work Crew (ICWC) program. The types of tasks ICWC members perform are related to street, park and utility maintenance. ICWC members are supervised by a crew leader provided by the state. The ICWC program provides up to ten crew
members and one crew leader for four days per week. This program helps provide offender crew members with valuable job skills and experience, while allowing the city to keep maintenance costs of our infrastructure low. Similar agreement with the Department of Corrections have been used in Eden Prairie since the early 1990s.
Attachment Agreement
Rev. 12/2020 Page 1 of 3
201904
State of Minnesota
Income Contract
SWIFT Contract No.:
This contract is between the State of Minnesota, acting through its Commissioner of Corrections, Institution Community
Work Crew, 1450 Energy Park Drive, St. Paul, Minnesota 55108 (“State”), and the City of Eden Prairie, whose designated
business address is 15150 Technology Drive, Eden Prairie, Minnesota, 55344 ("Purchaser").
State and Purchaser may be referred to jointly as “Parties.”
Recitals
1. Under Minn. Stat. §241.278 the State is empowered to enter into income contracts.
2. The Purchaser is in need of an Institution Community Work Crew (ICWC).
3. The State represents that it is duly qualified and agrees to provide the services described in this contract.
Accordingly, the Parties agree as follows:
Contract
Term of Contract
1.1 Effective date: July 1, 2024, or the date the State obtains all required signatures under Minnesota
Statutes Section 16C.05, subdivision 2, whichever is later.
1.2 Expiration date: June 30, 2026, or until all obligations have been satisfactorily fulfilled, whichever occurs
first.
State’s Duties
The State will:
2.1 Provide crew leader(s) who will supervise up to ten (10) offenders’ during four (4) 10-hour days of work
per week, including the hours crew leaders spend for daily preparation, communication and travel.
2.2 In coordination with the Purchaser, train each work crew in safety principles and techniques set forth by
the Purchaser and applicable federal, state and local agency requirements. Purchaser agrees that the
State has the responsibility and authority to refuse selected projects if it considers the projects beyond
the skill level of the crewmembers and/or unsafe to perform.
2.3 Provide required personal safety equipment and clothing needed for specific work.
2.4 Screen projects to ensure that appropriate staff are assigned.
2.5 Submit reports to the Purchaser upon request.
Purchaser’s Duties
The Purchaser will
3.1 Obtain all necessary permits or licenses or special authority for all projects that utilize ICWC labor.
3.2 Assign all work and coordinate material purchases and delivery through the ICWC crew leader for projects
to be performed by the State.
3.3 Hire any subcontractors utilized in the project.
3.4 Provide utilities at the work site and set up accounts for the purchase of materials and rental of specialized
tools or equipment needed for the work.
3.5 Meet with the State as necessary to provide project information needed by the State in the performance
of its’ duties.
246402
Rev. 12/2020 Page 2 of 3
Payment
The Purchaser will pay the State for all services performed by the State under this contract as follows:
4.1 Payment shall be made by the Purchaser to the State in the amount of fifty-three thousand three
hundred seventy-five and 00/100 dollars ($53,375.00) on July 1st , 2024, fifty-three thousand three
hundred seventy-five and 00/100 dollars ($53,375.00) on December 1st , 2024, fifty-three thousand
three hundred seventy-five and 00/100 dollars ($53,375.00) on July 1st , 2025, and fifty-three thousand
three hundred seventy-five and 00/100 dollars ($53,375.00) on December 1st , 2025. Any overtime
hours will be billed at the rate of eighty-five and 00/100 dollars ($85.00) per hour.
4.2 The total obligation of the Purchaser for all compensation and reimbursements to the State under this
contract is two hundred thirteen thousand five hundred and 00/100 dollars ($213,500.00), plus any
additional overtime hours, as its share of the cost of providing a crew leader and placing the work crews
into service on the ICWC Program during the term of this agreement. The Purchaser’s share includes
time scheduled for training, vacation, sick leave and holidays based on the terms and condition of the
crew leaders AFSCME bargaining agreement.
Authorized Representative
The State's Authorized Representative is Scott Miller, ICWC Supervisor or his successor, 2420 Long Lake Rd, Roseville,
Minnesota 55113
The Purchaser’s Authorized Representative is Jason Goblirsch, Parks Supervisor, City of Eden Prairie, 15150 Technology
Drive, Eden Prairie, Minnesota, 55344 or his successor. If the Purchaser’s Authorized Representative changes at any time
during this Contract, the Purchaser must immediately notify the State.
Assignment, Amendments, Waiver, and Contract Complete.
Assignment. The Purchaser may neither assign nor transfer any rights or obligations under this Contract
without the prior consent of the State and a fully executed assignment agreement, executed and
approved by the authorized parties or their successors.
Amendments. Any amendment to this Contract must be in writing and will not be effective until it has
been executed and approved by the authorized parties or their successors.
Waiver. If the State fails to enforce any provision of this Contract, that failure does not waive the provision
or its right to enforce it.
Contract Complete. This Contract contains all negotiations and agreements between the State and the
Purchaser. No other understanding regarding this Contract, whether written or oral, may be used to bind
either party.
Liability
Each party will be responsible for its own acts and behavior and the results thereof. Each party will be responsible for its
own acts and behavior and the results thereof. The liability of each party is set out respectively in chapter 3.736 and
Chapter 466.04 of the Minnesota Statutes and is subject to the limitations thereof. Nothing herein shall be construed to
limit either party from asserting against third parties any defenses or immunities (including common law, statutory and
constitutional) it may have or be construed to create a basis for a claim or suit when none would otherwise exist. This
provision shall survive the termination of this Agreement.
Government Data Practices.
The Purchaser must comply with the Minnesota Government Data Practices Act, Minn. Stat. Ch. 13, as it applies to all
data provided by the State under this contract. The civil remedies of Minn. Stat. § 13.08 apply to the release of the data
referred to in this clause by either the Purchaser or the State.
If the Purchaser receives a request to release the data referred to in this Clause, the Purchaser must immediately notify
the State. The State will give the Purchaser instructions concerning the release of the data to the requesting party
before the data is released.
Rev. 12/2020 Page 3 of 3
Publicity and Endorsement.
Publicity. Any publicity regarding the subject matter of this Contract must identify the State as the
sponsoring agency and must not be released without prior written approval from the State’s Authorized
Representative. For purposes of this provision, publicity includes notices, informational pamphlets, press
releases, information posted on corporate or other websites, research, reports, signs, and similar public
notices prepared by or for the Purchaser individually or jointly with others, or any subcontractors, with
respect to the program, publications, or services provided resulting from this Contract.
Endorsement. The Purchaser must not claim that the State endorses its products or services.
State Audits.
Under Minn. Stat. § 16C.05, subd. 5, the Purchaser’s books, records, documents, and accounting procedures and
practices relevant to this Contract are subject to examination by the State, the State Auditor, or Legislative Auditor, as
appropriate, for a minimum of six years from the expiration or termination of this Contract.
Governing Law, Jurisdiction, and Venue.
Minnesota law, without regard to its choice-of-law provisions, governs this Contract. Venue for all legal proceedings out
of this Contract, or its breach, must be in the appropriate state or federal court with competent jurisdiction in Ramsey
County, Minnesota.
Termination.
Either party may cancel this Contract at any time, with or without cause, upon 30 days’ written notice to the other party.
1. Purchaser
Print Name: ________________________________
Signature: _________________________________
Title: Date: ___________
Purchaser
Print Name: ________________________________
Signature: _________________________________
Title: Date: ___________
State Agency
With delegated authority
Print Name: ________________________________
Signature: __________________________________
Title: Date: ___________
Commissioner of Administration
As delegated to The Office of State Procurement
Print Name: ________________________________
Signature: __________________________________
Title: Date: ___________
Admin ID: __________________________________
CITY COUNCIL AGENDA
SECTION: Consent Calendar
DATE
May 7, 2024
DEPARTMENT / DIVISION
Scott Gerber/Fire Department
ITEM DESCRIPTION
Approve purchase from Knox Companies for Knox Box Key Secure Devices and Accessories
ITEM NO.
VIII.N.
Requested Action
Move to: Approve the purchase of Knox Box Key Secure Devices from Knox Companies. They have
provided a quote of $67,228.00. A second quote is attached from Midwest Security Products for $136,020.00. This purchase is being paid for with 2024 CIP funds allotted for this project. Synopsis
This purchase will provide new and replace older end of life key secure devices in police and fire vehicles to effectively secure Knox box keys for facilities throughout the city. These devices will enhance key security and assure effective service delivery.
Attachments Quote – Knox Company Quote – Midwest Security Products Goods and Services contract
CITY COUNCIL AGENDA
SECTION: Consent Calendar
DATE:
May 7, 2024
DEPARTMENT/DIVISION:
Matt Bourne, Parks and Natural Resources Manager, Parks and Recreation
ITEM DESCRIPTION:
Approve Contract with Hoffman & McNamara for Tree Planting Along Hidden Ponds Trail
ITEM NO.:
VIII.O.
Motion
Move to: Accept quote and authorize entering a Contract for Goods and Services with
Hoffman & McNamara for Tree Planting along Hidden Ponds Trail at an amount not to exceed of $21,489.00. Synopsis Staff has been working to remove ash along the trail west of Hidden Ponds Park with work being completed this spring. The next phase of the project is to replace the removed ash with a diverse
planting. This work utilizes Healthy Tree Canopy grant funds from Hennepin County. Six nursery and landscape vendors were contacted and responded to a Request for Bids. Hoffman & McNamara was the low bid. Background
This trail is located west of Hidden Ponds Park, in-between residential property. Previous ash removal work took place last winter, along the trail just north of Hidden Ponds Park, and will finish this spring. This contract will replace the 83 ash trees at a 1:1 ratio along the trail, using a variety of native trees. This work will complete our ash removal and replacement efforts along
the western section of this unpaved trail. The project will be completed by Fall 2024. The
remaining funds from the Hennepin County Healthy Tree Canopy grant will cover $18,869.03 and the remaining costs will be used as cash-match. Attachment
Bid Results
Contract for Goods and Services
SpeciesQuaitity Price Species Quaitity Price Species Quaitity Price Species Quaitity Price Species Quaitity Price Species Quaitity PriceBlack Walnut15 309.03 Pecan15 264 Blue Beech11 300 Black Walnut10 313.25 Black Walnut10 358 Black Walnut10 420Blue Beech15 309.03 Blue Beech15 264 Ironwood11 300 Bitternut Hickory10 232.93 Bitternut Hickory10 478 Blue Beech10 420Ironwood15 309.03 Ironwood8 273 N. Red Oak11 300 Shagbark Hickory10 269.5 Shagbark Hickory10 464 Ironwood10 420Bigtooth Aspen15 309.03 Black Cherry15 264 Swamp White Oak 11 300 Peacan10 423.5 Peacan10 452 Black Cherry10 420Black Cherry15 309.03 White Pine15 252 River Birch11 300 Blue Beech10 556.5 Blue Beech10 478 White pine5 420Eastern White Pine8 309.03 Silver Maple15 243 Hackberry12 300 Ironwood10 546.5 Ironwood8 523 Silver maple10 420St. Croix Elm11 300 Bigtooth Aspen10 367.5 Bigtooth Aspen10 501White Pine5 200 Black Cherry10 563.5 White pine5 241White pine5 334.08 Silver maple10 452Silver maple10 462Total: 83$25,650Total: 83$21,489Total: 8324,400$ Total: 9539,017.13$ Total: 83$37,219Total:55$34,860$34,088DaveyHartman Hoff & McNamLegacySavATreeCurbside
2024 03 08
Agreement for Contract Services
This Agreement ("Agreement") is made on the 7thday of May, 20 24, between the
City of Eden Prairie, Minnesota (hereinafter "City"), whose business address is 8080 Mitchell Road, Eden Prairie, MN 55344, and Hoffman & McNamara Co , a
Minnesota Company (hereinafter "Contractor") whose business address is 9045 180th St. E, Hasting, MN 55033. Preliminary Statement
The City has adopted a policy regarding the selection and hiring of contractors to provide a variety of services for City projects. That policy requires that persons, firms or corporations
providing such services enter into written agreements with the City. The purpose of this
Agreement is to set forth the terms and conditions for the provision of services by Contractor for Hidden Ponds Trail Tree Planting 2024 hereinafter referred to as the "Work".
The City and Contractor agree as follows:
1. Scope of Work. The Contractor agrees to provide, perform and complete all the provisions
of the Work in accordance with attached Exhibit A. Any general or specific conditions,terms, agreements, consultant or industry proposal, or contract terms attached to or a part ofExhibit A are declined in full and, accordingly, are deleted and shall not be in effect in anymanner.
2. Effective Date and Term of Agreement. This Agreement shall become effective as ofMay 7____ , 2024_. The Work shall be completed by November 1, 2024.
3. Obligations of Contractor. Contractor shall conform to the following obligations:a. Contractor shall provide the materials and services as set forth in Exhibit A.
b. Contractor and its employees will park in service areas or lots and use entries andexits as designated by City. Contractor's personnel will contact the appropriate person(i.e. receptionist, maintenance personnel, security, etc,) immediately upon entering
the building, and will sign in and out if required by City.
c. Care, coordination and communication by Contractor is imperative so that guests and
employees in the buildings are not disturbed or inconvenienced during theperformance of the contracted services.d. Contractor's personnel must be neat appearing, wear a uniform and badge that clearly
identifies them as a service contractor, and abide by City's no smoking policies.
e. Contractor must honor the City's request to reassign an employee for cause. Cause
may include performance below acceptable standards or failure to present thenecessary image or attitude, in the judgment of the owner, to present a first classoperation.
f. When necessary, Contractor's personnel will be provided with keys or access cards in order to perform their work. Any lost keys or cards that result in rekeying a space or other cost to the City will be billed back to the Contractor.
4. City's Obligations. City will do or provide to Contractor the following:a. Provide access to City properties as appropriate.
b. Provide restroom facilities as appropriate.
5. Compensation for Services. City agrees to pay the Contractor a fixed sum of $21,489 withas full and complete payment for the labor, materials and services rendered pursuant to thisAgreement and as described in Exhibit A, Exhibit B, and Exhibit C. a. Any changes in the scope of the work which may result in an increase to thecompensation due the Contractor shall require prior written approval by an authorizedrepresentative of the City or by the City Council. The City will not pay additionalcompensation for services that do not have prior written authorization.
b. If Contractor is delayed in performance due to any cause beyond its reasonablecontrol, including but not limited to strikes, riots, fires, acts of God, governmentalactions, actions of a third party, or actions or inactions of City, the time forperformance shall be extended by a period of time lost by reason of the delay.Contractor will be entitled to payment for its reasonable additional charges, if any, due to the delay.
6. Method of Payment.a. Contractor shall prepare and submit to City, on a monthly basis, itemized invoicessetting forth work perfo1med under this Agreement. Invoices submitted shall be paid in the same manner as other claims made to the City.
b. Claims. By making the claim for payment, the person making the claim is declaringthat the account, claim, or demand is just and correct and that no part of it has beenpaid.
c. No fuel surcharges or surcharges of any kind will be accepted nor will they be paid.
7. Project Manager. The Contractor shall designated a Project Manager and notify the City in writing of the identity of the Project Manager before starting work on the Project. The Project Manager shall be assisted by other staff members as necessary to facilitate thecompletion of the Work in accordance with the terms established herein. Contractor may notremove or replace the Project Manager without the approval of the City.
Standard Agreement for Contract Services 2024 03 08 Page 2 of 10
8. Standard of Care. Contractor shall exercise the same degree of care, skill and diligence in
the performance of its services as is ordinarily exercised by members of the profession undersimilar circumstances in Hennepin County, Minnesota. Contractor shall be liable to thefullest extent permitted under applicable law, without limitation, for any injuries, loss, or damages proximately caused by Contractor's breach of this standard of care. Contractor shall
put forth reasonable efforts to complete its duties in a timely manner. Contractor shall not beresponsible for delays caused by factors beyond its control or that could not be reasonably
foreseen at the time of execution of this Agreement. Contractor shall be responsible for
costs, delays or damages arising from unreasonable delays in the performance of its duties.
9. Insurance.
a. General Liability. Prior to starting the Work, Contractor shall procure, maintain andpay for such insurance as will protect against claims or loss which may arise out of
operations by Contractor or by any subcontractor or by anyone employed by any ofthem or by anyone for whose acts any of them may be liable. Such insurance shallinclude, but not be limited to, minimum coverages and limits of liability specified in
this Paragraph, or required by law.
b. Contractor shall procure and maintain the following minimum insurance coverages
and limits of liability for the Work:
Worker's Compensation
Employer's Liability
Commercial General Liability
Comprehensive Automobile
Liability
Statutory Limits
$500,000 each accident $500,000 disease policy limit
$500,000 disease each employee
$1,000,000 property damage and bodily
mJury per occurrence $2,000,000 general aggregate $2,000,000 Products Completed Operations Aggregate
$100,000 fire legal liability each occurrence $5,000 medical expense
$1,000,000 combined single limit each accident (shall include coverage for all owned, hired and
non-owed vehicles.)
Umbrella or Excess Liability $1,000,000
c. Commercial General Liability. The Commercial General Liability Policy shall be on ISO form CG 00 01 12 07 or CG 00 01 04 13, or the equivalent. Such insurance shallcover liability arising from premises, operations, independent contractors, products-
Standard Agreement for Contract Services 2024 03 08 Page 3 of 10
completed operations, personal and advertising injury, and liability assumed under an insured contract (including the tort liability of another assumed in a business contract). There shall be no endorsement or modification of the Commercial General
Liability form arising from pollution, explosion, collapse, underground property damage or work performed by subcontractors.
d. Contractor shall maintain "stop gap" coverage if Contractor obtains Workers'
Compensation coverage from any state fund if Employer's liability coverage is notavailable.
e. All policies, except the Worker's Compensation Policy, shall name the "City of EdenPrairie" as an additional insured.
f. All policies, except the Worker's Compensation Policy, Automobile Policy, andProfessional Liability Policy, shall name the "City of Eden Prairie" as an additionalinsured including products and completed operations.
g. All polices shall contain a waiver of subrogation in favor of the City.
h. All General Liability policies, Automobile Liability policies, and Umbrella policies
shall contain a waiver of subrogation in favor of the City.
1. All polices, except the Worker's Compensation Policy, shall insure the defense and
indemnity obligations assumed by Contractor under this Agreement.
J. Contractor agrees to maintain all coverage required herein throughout the term of the Agreement and for a minimum of two (2) years following City's written acceptance
of the Work.
k. It shall be Contractor's responsibility to pay any retention or deductible for the
coverages required herein.
I. All policies shall contain a prov1s1011 or endorsement that coverages affordedthereunder shall not be cancelled or non-renewed or restrictive modifications added,
without thirty (30) days' prior notice to the City, except that if the cancellation or non-renewal is due to non-payment, the coverages may not be terminated or non-renewed without ten (10) days' prior notice to the City.
m. Contractor shall maintain in effect all insurance coverages required under thisParagraph at Contractor's sole expense and with insurance companies licensed to do business in the state in Minnesota and having a current A.M. Best rating of no less
than A-, unless specifically accepted by City in writing.
n. A copy of the Contractor's Certificate of Insurance which evidences the compliance with this Paragraph, must be filed with City prior to the start ofContractor's Work. Upon request a copy of the Contractor's insurance declaration
Standard Agreement for Contract Services 2024 03 08 Page 4 of 10
page, Rider and/or Endorsement, as applicable shall be provided. Such documents evidencing Insurance shall be in a form acceptable to City and shall provide satisfactory evidence that Contractor has complied with all insurance requirements. Renewal certificates shall be provided to City prior to the expiration date of any of the required policies. City will not be obligated, however, to review such Certificate of Insurance, declaration page, Rider, Endorsement or certificates or other evidence of insurance, or to advise Contractor of any deficiencies in such documents and receipt thereof shall not relieve Contractor from, nor be deemed a waiver of, City's right to enforce the terms of Contractor's obligations hereunder. City reserves the right to examine any policy provided for under this paragraph.
o. Effect of Contractor's Failure to Provide Insurance. If Contractor fails to providethe specified insurance, then Contractor will defend, indemnify and hold harmless the City, the City's officials, agents and employees from any loss, claim, liability and expense (including reasonable attorney's fees and expenses of litigation) to the extentnecessaiy to afford the same protection as would have been provided by the specifiedinsurance. Except to the extent prohibited by law, this indemnity applies regardless ofany strict liability or negligence attributable to the City (including sole negligence) and regardless of the extent to which the underlying occurrence (i.e., the event giving rise to a claim which would have been covered by the specified insurance) is attributable to the negligent or othe1wise wrongfol act or omission (including breach of contract) ofContractor, its subcontractors, agents, employees or delegates. Contractor agrees thatthis indemnity shall be construed and applied in favor of indemnification. Contractoralso agrees that if applicable law limits or precludes any aspect of this indemnity, thenthe indemnity will be considered limited only to the extent necessaiy to comply with that applicable law. The stated indemnity continues until all applicable statutes oflimitation have run.
If a claim arises within the scope of the stated indemnity, the City may reqmreContractor to:
1. Furnish and pay for a surety bond, satisfact01y to the City, guaranteeingperformance of the indemnity obligation; or
11. Furnish a written acceptance of tender of defense and indemnity from Contractor's insurance company.
Contractor will take the action required by the City within fifteen ( 15) days of receiving notice from the City.
10. Indemnification. Contractor will defend and indemnify City, its officers, agents, andemployees and hold them harmless from and against all judgments, claims, damages, costsand expenses, including a reasonable amount as and for its attorney's fees paid, incurred or for which it may be liable resulting f rom any breach of this Agreement by Contractor, its agents, contractors and employees, or any negligent or intentional act or omission performed,taken or not performed or taken by Contractor, its agents, contractors and employees, relativeto this Agreement. City will indemnify and hold Contractor harmless from and against any
Standard Agreement for Contract Services 2024 03 08 Page 5 of 10
loss for injuries or damages arising out of the negligent acts of the City, its officers, agents or
employees.
11. Warranty. The Contractor expressly warrants and guarantees to the City that all Workperformed and all materials furnished shall be in accord with the Agreement and shall be free
from defects in materials, workmanship, and operation which appear within a period of oneyear, or within such longer period as may be prescribed by law or in the terms of theAgreement, from the date of City's written acceptance of the Work. The City's rights underthe Contractor's warranty are not the City's exclusive remedy. The City shall have all other
remedies available under this Agreement, at law or in equity.
Should any defects develop in the materials, workmanship or operation of the system within
the specified period, upon notice f rom the City, the Contractor agrees, within ten (10)calendar days after receiving written notice and without expense to the City, to repair, replaceand in general to perform all necessary corrective Work with regard to the defective or
nonconforming Work or materials to the satisfaction of the City. THE FOREGOING SHALL
NOT IN ANY MANNER LIMIT THE CITY'S REMEDY OR THE CONTRACTOR'SLIABILITY TO THOSE DEFECTS APPEARING WITHIN THE WARRANTY PERIOD.
The Contractor agrees to perform the Work in a manner and at a time so as to minimize anydamages sustained by the City and so as to not interfere with or in any way disrupt the operation of the City or the public.
The corrective Work referred to above shall include without limitation, (a) the cost ofremoving the defective or nonconforming Work and materials from the site, (b) the cost ofcorrecting all Work of other Contractors destroyed or damaged by defective ornonconforming Work and materials including the cost of removal of such damaged Work
and materials form the site, and ( c) the cost of correcting all damages to Work of otherContractors caused by the removal of the defective or nonconforming Work or materials.
The Contractor shall post bonds to secure the warranties.
12. Termination.
a. This Agreement may be terminated at any time by either party for breach or non-
performance of any provision of this Agreement in accordance with the following.The party ("notifying party") who desires to terminate this Agreement for breach or non-performance of the other party ("notified party") shall give the notified party
notice in writing of the notifying party's desire to terminate this Agreementdescribing the breach or non-performance of this Agreement entitling it to do so. Thenotified party shall have five (5) days from the date of such notice to cure the breachor non-perfonnance. Upon failure of the notified paiiy to do so, this Agreement shall
automatically terminate.
b. Upon the termination of this Agreement, whether by expiration of the original or anyextended term or terms hereof, or for any other reason, Contractor shall have the
right, within a reasonable time after such termination to remove from City's premisesany and all of Contractor's equipment and other property. Except for liability
Standard Agreement for Contract Services 2024 03 08 Page 6 of IO
resulting from acts or omissions of a party, arising, taken or omitted prior to such termination, the rights and obligations of each party resulting from this Agreement shall cease upon such termination. Any prior liability of a party shall survive
termination of this Agreement.
c. In the event of dissolution, termination of existence, insolvency, appointment of a
receiver, assignment for the benefit of creditors, or the commencement of any
proceeding under any bankruptcy or insolvency law, or the service of any warrant,attachment, levy or similar process involving Contractor, City may, at its option in addition to any other remedy to which City may be entitled, immediately terminate
this Agreement by notice to Contractor, in which event, this Agreement shallterminate on the notice becoming effective.
13. Independent Contractor. Contractor is an independent contractor engaged by City to perform the services described herein and as such (i) shall employ such persons as it shall
deem necessary and appropriate for the performance of its obligations pursuant to thisAgreement, who shall be employees, and under the direction, of Contractor and in no respectemployees of City, and (ii) shall have no authority to employ persons, or make purchases of
equipment on behalf of City, or otherwise bind or obligate City. No statement herein shall be construed so as to find the Contractor an employee of the City.
14. Mediation. Each dispute, claim or controversy arising f rom or related to this agreementshall be subject to mediation as a condition precedent to initiating arbitration or legal or
equitable actions by either party. Unless the parties agree otherwise, the mediation shall be in accordance with the Commercial Mediation Procedures of the American ArbitrationAssociation then currently in effect. A request for mediation shall be filed in writing with theAmerican Arbitration Association and the other party. No arbitration or legal or equitable
action may be instituted for a period of 90 days from the filing of the request for mediationunless a longer period of time is provided by agreement of the parties. Cost of mediation
shall be shared equally between the parties. Mediation shall be held in the City of Eden
Prairie unless another location is mutually agreed upon by the parties. The parties shallmemorialize any agreement resulting from the mediation in a mediated settlement agreement,which agreement shall be enforceable as a settlement in any court having jurisdiction thereof.
GENERAL TERMS AND CONDITIONS
15. Assignment Neither party shall assign this Agreement, nor any interest arising herein,without the written consent of the other party.
Standard Agreement for Contract Services 2024 03 08 Page 7 of 10
16. Compliance with Laws and Regulations. In providing services hereunder, the
Contractor shall abide by statutes, ordinances, rules, and regulations pertaining to the
provisions of services to be provided. Any violation of statutes, ordinances, rules andregulations pertaining to the services to be provided shall constitute a material breach of
this Agreement and entitle the City to immediately terminate this Agreement.
17. Conflicts. No salaried officer or employee of the City and no member of the Council ofthe City shall have a financial interest, direct or indirect, in this Agreement. The
violation of this provision renders the Agreement void.
18. Counterparts. This Agreement may be executed in multiple counterparts, each of which
shall be considered an original.
19. Damages. In the event of a breach of this Agreement by the City, Contractor shall not be
entitled to recover punitive, special or consequential damages or damages for loss of
business.
20. Employees. Contractor agrees not to hire any employee or former employee of City andCity agrees not to hire any employee or former employee of Contractor prior to ten11ination of this Agreement and for one ( 1) year thereafter, without prior writtenconsent of the former employer in each case.
21. Enforcement. The Contractor shall reimburse the City for all costs and expenses,including without limitation, attorneys' fees paid or incurred by the City in connectionwith the enforcement by the City during the term of this Agreement or thereafter of any
of the rights or remedies of the City under this Agreement.
22. Entire Agreement, Construction, Application and Interpretation. This Agreement is in furtherance of the City's public purpose mission and shall be construed, interpreted,
and applied pursuant to and in conformance with the City's public purpose mission. Theentire agreement of the parties is contained herein. This Agreement supersedes all oralagreements and negotiations between the parties relating to the subject matter hereof as
well as any previous agreements presently in effect between the parties relating to the subject matter hereof. Any alterations, amendments, deletions, or waivers of theprovisions of this Agreement shall be valid only when expressed in writing and duly
signed by the parties, unless otherwise provided herein.
23. Governing Law. This Agreement shall be controlled by the laws of the State ofMinnesota.
24. Non-Discrimination. During the performance of this Agreement, the Contractor shallnot discriminate against any employee or applicants for employment because of race,color, creed, religion, national origin, sex, marital status, status with regard to publicassistance, disability, sexual orientation or age. The Contractor shall post in places
available to employees and applicants for employment, notices setting forth the provisionof this non-discrimination clause and stating that all qualified applicants will receive
Standard Agreement for Contract Services 2024 03 08 Page 8 of IO
consideration for employment. The Contractor shall incorporate the foregoing requirements of this paragraph in all of its subcontracts for program work, and will
require all of its subcontractors for such work to incorporate such requirements in all subcontracts for program work. The Contractor further agrees to comply with all aspects of the Minnesota Human Rights Act, Minnesota Statutes 363.01, et. seq., Title VI of the
Civil Rights Act of 1964, and the Americans with Disabilities Act of 1990.
25. Notice. Any notice required or permitted to be given by a party upon the other is given in
accordance with this Agreement if it is directed to either party by delivering it personallyto an officer of the party, or if mailed in a sealed wrapper by United States registered orcertified mail, return receipt requested, postage prepaid, or if deposited cost paid with a
nationally recognized, reputable overnight courier, properly addressed to the addresslisted on page 1 hereof. Notices shall be deemed effective on the earlier of the date ofreceipt or the date of mailing or deposit as aforesaid, provided, however, that if notice is
given by mail or deposit, that the time for response to any notice by the other party shallcommence to run one business day after any such mailing or deposit. A party may
change its address for the service of notice by giving written notice of such change to theother party, in any manner above specified, 10 days prior to the effective date of suchchange.
26. Rights and Remedies. The duties and obligations imposed by this Agreement and therights and remedies available thereunder shall be in addition to and not a limitation of any
duties, obligations, rights and remedies otherwise imposed or available by law.
27. Services Not Provided For. No claim for services furnished by the Contractor not
specifically provided for herein shall be honored by the City.
28. Severability. The provisions of this Agreement are severable. If any portion hereof is,for any reason, held by a court of competent jurisdiction to be contrary to law, such
decision shall not affect the remaining provisions of this Agreement.
29. Statutory Provisions.a. Audit Disclosure. The books, records, documents and accounting procedures and
practices of the Contractor or other paiiies relevant to this Agreement are subject to examination by the City and either the Legislative Auditor or the State Auditor for a
period of six ( 6) years after the effective date of this Agreement.
b. Data Practices. Any repmis, information, or data in any form given to, orprepared or assembled by the Contractor under this Agreement which the City requests to
be kept confidential, shall not be made available to any individual or organization withoutthe City's prior written approval. This Agreement is subject to the Minnesota GovernmentData Practice Act, Minnesota Statutes Chapter 13 (Data Practices Act). All government
data, as defined in the Data Practices Act Section 13.02, Subd 7, which is created,collected, received, stored, used, maintained, or disseminated by Contractor in performing any of the functions of the City during performance of this Agreement is
subject to the requirements of the Data Practice Act and Contractor shall comply with
Standard Agreement for Contract Services 2024 03 08 Page 9 of 10
30.
those requirements as if it were a government entity. All subcontracts entered into by Contractor in relation to this Agreement shall contain similar Data Practices Act compliance language.
Waiver. Any waiver by either party of a breach of any provisions of this Agreement shall not affect, in any respect, the validity of the remainder of this Agreement.
Executed as of the day and year first written above.
Standard Agreement for Contract Services 2024 03 08 Page 10 of 10
CITY OF EDEN PRAIRIE
Mayor
City Manager
CONTRACTOR
By
Mike McNamara, Its: President
Exhibit A: SPECIFICATIONS
Exhibit A: SPECIFICATIONS
REQUEST FOR ESTIMATES
CITY OF EDEN PRAIRIE
HIDDEN PONDS TRAIL TREE PLANTING PROJECT
18300 Twilight Tri, Eden Prairie, MN 55346
I. GENERAL: The following publications are hereby as fully incorporated into and made a part of these City
of Eden Prairie (hereafter referred to as the "City") tree planting specifications as if attached hereto, to
which the contract awardee (hereafter referred to as the "Contractor") must meet and comply.
a. NOMENCLATURE: Trees shall conform to nomenclature of "Standardized Plant Names" as
adopted by the American Joint Committee on Horticulture Nomenclature (latest edition).
b. GRADING STANDARDS: Grading standards shall conform to the American Nursery and
Landscape Association as published in "American Standard for Nursery Stock" (ANSI 260.1-
2014). No substitution of grade of tree shall be permitted without written permission from the
City. Each tree shall be properly identified with legible waterproof tags securely fastened to the
tree.
c. CERTIFICATES AND DOCUMENTS: The Contractor shall meet and comply with all federal, state,
and local regulations and requirements involving the nursery stock provided to the City. This
includes obtaining inspection certificates, quarantine compliance documents, and any special
inspections that may be required. The required certificates and documents shall be supplied to
the City before planting will be allowed. The Contractor shall be appropriately certified or
licensed in the state where the trees were grown or by the State of Minnesota.
d. Certificates of Inspection: Certificates shall accompany the invoice for each shipment of trees as
may be required by law for transportation. Certificates of inspection by the state of origin will
be required for all trees supplied to the City. The City must receive all required certificates
before planting will be allowed. Inspection by Federal or State governments at the place of
growth or holding lot does not preclude rejection of the trees by the City for use under this
contract.
e. Grower Certificates: Trees shall be nursery grown by a nursery certified by the appropriate
plant regulatory agency(s) where the trees were grown and inspected. Proof of certification and
inspection shall be provided to the City upon request.
Page I of 11
II. MATERIALS AND STANDARDS:
a. TREES: Specific requirements not covered under this section, including the tree species,
estimated quantities, tree sizes, stock types, and tree forms, can be found on the bid form in
Exhibit C.
b. Quality and Condition: Trees must meet the quality and condition standards set forth in
"American Standard for Nursery Stock" (ANSI 260.1-2014).
c. Stock Size: The determining measurements for trees shall be the caliper and/or height. Caliper
and height shall be measured using the procedures described in "Section 1.2" of the "American
Standard for Nursery Stock" (ANSI 260.1-2014).
i. Container Grown: Stock must meet a minimum caliper measurement of 1". Stock can
be delivered in either a #7, #10 or #15 pot. If the stock is delivered in a #7 or #10 pot,
the caliper must not exceed 1.25". If stock is delivered in a #15 pot, the caliper must not
exceed 1. 75".
ii. Bare-root: Stock must meet a minimum caliper measurement of 1" and not greater than
2.25".
d. Nursery Stock Types: Trees must meet the quality and condition standards set forth in
"American Standard for Nursery Stock" (ANSI 260.1-2014).
i. Container Grown: Trees shall be healthy, vigorous, well rooted, and established in the
container in which they are delivered. They shall be a tree transplanted into a container
and grown in that container long enough for new fibrous roots to have developed so
that the root mass will retain its shape and hold together when removed from
container. Containers shall meet the size specifications set for in "Section 2'' and
"Section 4" of the "American Standard for Nursery Stock" (ANSI 260.12014). The
container shall be sufficiently rigid as to protect the root mass during shipment.
Container grown trees found to have excessive encircling roots, as determined by the
City, will be rejected.
ii. Bare-root: Trees shall have well branched root systems that are free of encircling or
damaged roots. Bare-root trees shall meet the root system standards set for in "Section
2.7" of the "American Standard for Nursery Stock" (ANSI 260.1-2014).
iii.Change in Stock Type: The Contractor may not change stock type without prior
approval from the City.
Page 2 of 11
e. WATER: The Contractor shall supply all water, equipment, hose, attachments, and accessories
needed for the adequate irrigation of the planting pits as is required for tree planting. A top-fill
tank with an atmospheric brake is preferred. The water to be used for irrigation shall be fresh,
clean, and free of any impurities. Any water obtained as a waste or by-product of industrial
operations is not acceptable. Water may be obtained at the City of Eden Prairie Water
Treatment Plant located at 14100 Technology Drive Eden Prairie, MN 55344. If the Contractor
choses to refill water here, an account must be set up with the water plant a week prior to using
the station and the cost of water must be incorporated into the lump sum of this contract.
f.STAKING TREES:
i. Stakes used for securing bare-root, container grown or balled and burlapped trees shall
be five (5) feet in length and sturdy to withstand one year of rootball support. A
minimum of two stakes shall be used per tree; three for bare root trees. Straps used to
secure the tree to each stake shall be between three quarter(¾) inch and two (2) inch
wide, biodegradable strapping, secured to the stakes with staples or wire as
appropriate.
g. MULCH: Wood mulch used for mulching trees must be weed seed free and aged.
h. HYDROGEL: All bare-root trees shall have roots treated with a hydrogel solution prior to
transporting to planting locations. The hydrogel shall be Terra-Sorb Hydrogel ™-Fine Grade
(Lebanon Seaboard Corporation, 1600 East Cumberland Street, 1600 East Cumberland Street,
Lebanon, PA 17042, (800) 233-0628), or an approved equivalent. The hydrogel shall be delivered
in the manufacturer's original product container and shall be mixed in accordance with the
manufacturer's directions. The Contractor shall premix the solution of water and hydrogel at
least twenty (20) minutes prior to dipping the tree roots to allow time for the co-polymer to
expand and store water. The tree roots should be dipped long enough to allow the gel to fully
adhere. The Safety Data Sheet (SDS) for any hydrogel shall be provided to the City before use
can occur. The cost of hydrogel shall be included in the unit price per bare-root tree on the bid
form.
i. CRITTER PROTECTION: Critter protection must be corrugated tree guards, 4 ft in length and 3"
in diameter. Each tree must receive a tree guard. The cost of the tree guard shall be included in
the unit price per tree on the bid form.
Ill. NURSERY STOCI< PREPARATION:
a. STORAGE, HANDLING, AND TRANSPORTATION: Handle trees at all times so that a minimum of
disturbance to roots, trunks and branches will occur.
Page 3 of 11
b. Lifting of Container Grown and Balled and Burlapped Trees: Balled and burlapped trees shall
be lifted from the bottom only, using straps or webbing to avoid cutting into the root ball. Trees
may also be lifted with power equipment using forks or front end loaders. Care must be taken to
avoid pressure squeezing the ball or damage to the trunk. Soil balls damaged during lifting may
cause the affected trees to be rejected for which the Contractor will be required to provide
replacements. Container grown trees shall be lifted and handled by the container only and
never by the tree trunk or branches.
c. Bare-root Storage and Transport: All bare-root trees shall be heeled in hydrated wood mulch or
pea gravel at the Contractor's holding lot or kept in cold storage until transported to the
planting site. Bare-root trees shall be transported either in an enclosed trailer or wrapped in
tarpaulin to prevent root drying.
d. Hydrogel application: All bare-root tree roots shall be dipped in a solution of hydrogel prior to
transportation to planting locations; to prevent root drying and to assist in the moisture
retention after planting.
e. Sweating: Some bare-root species must be sweated prior to installation in order to break
dormancy. If buds have begun to swell upon arrival to the holding lot, plant dormancy has been
broken and further sweating is not required. Bare-root trees that require sweating will not be
accepted if they have not broken dormancy either naturally or by way of sweating. The
Contractor is required to know which trees need to be sweated.
f. Tying of Branches: When required, branches shall only be tied with rope or twine. The branches
shall be tied in such a manner that no damage will occur to the bark or branches and untied as
soon as practical.
g. Wind, Sun, and Freeze Protection: Trees shall be protected by the use of tarpaulin, cover, or
mulch to prevent drying out of the foliage, branches, roots and root balls; this is especially
important during transport when the trees are leafed out. Trees may need to be mulched in the
holding lot during very low temperatures that may occur after delivery in early spring or late fall.
h. Anti-Desiccant Spray: The spray may be applied to trees when needed. Trees may be resprayed
after planting, at the request of the Contractor and with City approval.
i. Delivery: The Contractor shall exercise care in selecting a delivery date for the best coordination
with tree planting operations.
IV. TREE PLANTING: In general, all tree planting operations shall be conducted in an orderly, efficient, and
professional manner, using care to keep the entire area affected by the planting operations as clean and
safe as possible.
a. PLANTING Tl MELINE: Planting operations shall be conducted under favorable weather
conditions between September 15, 2024 and November 1, 2024.
Page 4 of 11
b. PLANTING LOCATIONS: Trees will be planted along Hidden Ponds trail to the west of Dell Rd
from 18392 Twilight Trail to 19084 Twilight Trail. A map of the general planting area can be
found in Exhibit B. Locations for individual trees will be marked by the City with white painted
stakes prior to planting. The City reserves the right to change planting locations based on
location of underground utilities.
c. Marking Request: The Contractor shall contact the City seven (7) days in advance of excavating
for planting so that the City may mark all planting locations for utility verification.
d. Utility Verification: The Contractor shall contact Gopher State One Call (GSOC) ((800) 252-1166)
a minimum of five (5) days in advance of excavating for planting. Planting locations will be
marked by the City with a white painted X on the ground and white painted stake.
e. Proximity to Utilities: The Contractor shall be responsible for all damages resulting from neglect
or failure to comply with the above requirements. Trees shall not be planted closer than ten (10)
feet from water service connections or five (5) feet from gas lines unless so directed by the City.
If not directed by the City, any excavation or planting that occurs closer than these specified
minimum distances to existing utilities shall be backfilled, restored, and replanted by the
Contractor as specified by the City.
f. PLANTING LOCATION DELIVERY: Trees shall be delivered to the planting location on the day of
planting. No trees may be delivered prior to the day they are to be planted. The trees should be
planted immediately upon arrival at the planting location to prevent root desiccation and death.
g. PLANT PIT EXCAVATION: Excavate tree planting pits at the approved location as specified
herein. Pits shall not be left unfilled overnight.
i. Minimum Pit Size: The minimum planting pit size shall be the depth of the root ball and
no greater, with the uppermost first order root within one inch of ground level. The
planting hole shall be two times greater than the diameter of the root ball or root
system. Excess soil from pits shall be cleaned up immediately after planting and shall
not be left at the planting site overnight. Bare-root trees shall have a planting pit large
enough to allow for the natural placement of the roots in the soil.
ii. Subsurface Conditions: The City shall be notified immediately of all subsurface drainage
or soil conditions which the Contractor considers to be detrimental to the growth
and/or survival of new trees. The Contractor shall be responsible for the removal of all
other underground obstructions. Obstructions shall be removed to a depth of six (6)
inches below or outside the pit requirements at no additional cost. If the removal is
impossible or unfeasible, the City shall be notified and may elect to select an alternate
planting location.
iii. Pit Excavation: All planting holes may be excavated by mechanical equipment, such as
an auger, unless otherwise approved by the City prior to planting. Hand digging may be
Page 5 of 11
required at some locations, where site access or utilities prevent the use of mechanical
equipment, at no additional cost to the bid.
h. SETTING TREES: The Contractor shall employ personnel familiar with proper planting
procedures and a qualified foreperson, who will perform on-site supervision of all planting
related work.
i. Preparation: Preparation differs depending on the type of tree stock. Failure to comply with any
of the following processes may result in the City requiring the Contractor to remove and replant,
or replace a tree at no additional cost to the City.
i. Container Trees: Remove the container carefully to maintain the integrity of the root
ball. Remove any excess soil from the top of the root ball until the first coarse or
structural root is found. Examine the root ball for any roots that encircle and prune off
these roots at the point where they begin to circle with a sharp instrument insuring a
clean cut. All container trees shall be "box cut" (approximately one inch of soil and roots
are removed from each side and bottom of the root ball) with a sharp instrument
insuring a clean cut. Containers are to be disposed of off-site.
ii. Bare-root Trees: Broken or damaged roots shall be pruned back to live wood prior to
planting. The planting pit shall be large enough to allow for the natural placement of the
tree roots. Bare-root tree roots must be protected from drying during storage,
transport, and planting.
j. Positioning: Remove all twine or rope from the branches of the tree before positioning the tree
in the planting hole. The Contractor should not damage the tree trunk or branches while
positioning the tree in the hole. Each tree shall be planted plumb prior to backfilling. Trees shall
be planted so that the first-order structural root is within one inch of ground level without
exceeding ground level.
k. Container Grown Trees: Proper planting depth shall be obtained by removing any excess soil
from the top of the root ball to the level of the root crown. The root ball shall be placed in the
planting pit to ensure that the uppermost first order root is within one inch of ground level
without exceeding ground level. The tree itself shall not be raised, pulled up, or loosened in the
soil ball in an attempt to reach proper planting depth. Doing so will result in the tree being
rejected and will require a replacement tree to be planted by the Contractor at no additional
cost to the City.
I. BACKFILLING AND WATERING: Brace trees in the plumb position when backfilling. Use care to
eliminate any air pockets. Sod, woody material, and any other plant material shall not be used
as backfill, but rather removed and legally disposed of off-site. When the planting pit has been
backfilled approximately two-thirds full, add water, thoroughly wetting the soil, before placing
and lightly tamping the remainder of the soil to the top of the pit. The initial watering should be
enough water to hydrate the root ball and the soil in the planting pit, but should not be so
excessive that the tree will not stand plumb. A soil saucer to retain water shall not to be made
Page 6 of 11
with the backfill material. Additional soil shall be added, as needed, to return the planting area
to grade. Any excess soil shall be removed and legally disposed of off-site.
m. MULCHING: Provide all trees with a layer of wood mulch. Place material loosely around base of
tree, such that the mulch is not in contact with the trunk, to form a saucer with a berm on the
outer edge to help retain water. The mulch layer surrounding a tree shall be four (4) inches deep
and shall extend out from the trunk twenty-four (24) inches to thirty-six (36) inches.
n. STAl<ING:
i. Staking at the time of planting is required when trees are unable to stand plumb, or at
the discretion of the City forester. Stakes shall be placed at least twelve (12) inches from
the root ball and driven down a minimum of eighteen (18) inches or until firm. Fasten
the stake to the tree with biodegradable flexible strap or webbing. Straps must be
attached on the lower one-third of the main stem and must not interfere with any
lateral branches. Straps must allow for movement of the lower stem and are not to be
taut. The tree should stand plumb before and after the completion of all staking
operations.
ii. The cost of bare-root staking shall be included in the unit price per bare-root tree on the
bid form.
iii. It is the responsibility of the Contractor to contact Gopher State One-Call before staking
commences if this work is done after approved timeframe of the initial utility locate.
The Contractor shall provide the City forester with a list of staked trees and dates on
which they were staked. T-post staking shall be performed by the Contractor at no
additional cost to the City if needed.
o. Critter Protection: Critter protection shall be installed to cover the entire trunk of the tree such
that the trunk is covered from the root collar all the way to the first main branch. Critter
protection must cover the entire main stem with additional space to allow for stem growth and
air circulation.
p. CLEAN-UP: The planting site area shall be restored to its original condition by the Contractor.
This work shall include replacement of sod destroyed by the planting operations, excluding the
planting pit, and filling in any indentations made by the Contractor. Sidewalks, streets, and
other paved areas shall be cleaned of any dirt, mud, or debris that accumulated from the
planting operation. Loose dirt in the area surrounding the planting site shall be raked up. The
clean-up should take place as the work progresses and shall be complete at the end of each
working day. The Contractor shall be held responsible for any damage to public or private
property as a result of the planting operations.
V. INSPECTION: The Contractor shall reach out to the City to inform the City that planting has been
completed. The City will inspect the planting work and make the Contractor aware of any corrections, if
any are present. Corrections must be made before payment will occur.
Page 7 of 11
VI. WATERING: The Contractor will be responsible for watering trees for the first 60 days after planting.
Watering should occur on a twice-weekly basis when precipitation for the week prior is less than 2" and
significant rain is not forecasted for the week. The maximum number of waterings will be 8 in the 60 day
period.
VII. EXTENDED MAINTENANCE AND GUARANTEE PERIOD: Provisional Acceptance shall constitute the
beginning of the Extended Maintenance and Guarantee Period.
a. EXTENDED MAINTENANCE: Required Extended Maintenance shall consist of replacing staking
materials and resetting trees to plumb or proper grade, including staking if needed, as
determined by the City. The City will occasionally inspect trees and notify the Contractor of any
trees that need to be re-staked or staked. Extended Maintenance shall continue until the end of
the Guarantee Period.
b. GUARANTEE PERIOD: All trees purchased and planted by the Contractor under this contract
shall be guaranteed by the Contractor to be in good, healthy and flourishing condition until July
1 of the year following planting. Trees that are in good, healthy, and flourishing condition as
determined by the City at the end of the Guarantee Period will be granted Final Acceptance.
c. REPLACEMENTS: At the end of the Guarantee Period, the City will inspect trees to determine if
they are in good, healthy, and flourishing condition. Any tree that is not free of dead branches
and twigs, does not bear foliage of normal density, size, and color, and is determined by the City
to not meet the quality and condition requirements shall either be pruned or replaced by the
Contractor, as determined by the City. No tree shall be replaced prior to the end of the
Guarantee Period unless authorized by the City. Replacement trees shall be subject to all
requirements and specifications set forth in this contract other than Extended Maintenance and
Guarantee Period. Replacements shall be of the same species, stock, and size unless otherwise
approved by the City. Replacement trees must pass Initial Inspection to be granted Final
Acceptance
i. Replacement Notification: Locations of trees to be replaced under guarantee will be
sent to the Contractor by the City at the end of the Guarantee Period.
ii. Replacement Planting Dates: Trees requiring replacement shall be replaced between
October 1 and October 15 of the year following original planting. If replacements cannot
be planted during this time due to circumstances beyond the Contractors control, such
as plant material not being available or it being the wrong planting season for certain
species, a notification in writing shall be made to the request an extension to the
contract deadline as soon as it is determined that such an extension is necessary.
iii.Acts of God: The Contractor will not be held responsible for tree mortality resulting
from an act of God. For the purpose of these specifications, circumstances include
floods, storms, etc.; or any factor, as determined by the City, which makes it impossible
for the Contractor to plant replacement trees.
Page 8 of 11
iv. Failure to Replace: If replacement cannot occur due to one or more of the above
circumstances, an agreement between the Contractor and the City shall be reached that
will fulfill the needs of the City and the spirit of the contract.
v. Vandalism: The Contractor shall not be responsible for replacement of any tree which
has died or been damaged as the clear result of vandalism. For the purpose of these
specifications, vandalism shall include the following: damage caused by motor vehicles;
persons; animals; and/or mechanical damage, such as caused by snowplows, lawn
mowers, weed whips or other mechanical injuries.
VIII. FINAL ACCEPTANCE: Final Acceptance is granted in writing to the Contractor by the City and such
document shall note the complete fulfillment of all requirements and release the Contractor from any
further requirements under this contract. The Contractor, upon receipt of the Final Acceptance
document, shall be eligible for complete payment under the terms of this contract.
Page 9 of 11
EXHIBIT B -SITE MAP (pdf on file for file combine)
Page 10 of 11
CITY COUNCIL AGENDA
SECTION: Consent Calendar
DATE:
May 7, 2024
DEPARTMENT/DIVISION:
Scott Riley
Public Works / Streets
ITEM DESCRIPTION:
Award Contract for Curb and Gutter Replacement to Curb Masters Inc.
ITEM NO.:
VIII.P.
Requested Action
Move to: Award the contract for removal and replacement of curb and gutter to Curb Masters Incorporated for a cost not to exceed $150,000.00 Synopsis
A request for quotes was sent out for the removal and installation of approximately 3,000 LF of surmountable curb and gutter in the overlay project area. Two Quotes were received with Curb Masters Inc. being the lowest at $139,555.00 with costs not to exceed $150,000.00. Bidder Estimate
Curb Masters Inc $139,555
MN State Curb and Gutter $193.525
CR Fischer and Metro Paving No Bid
Background Information
This contract aims to help Streets Division Staff with the removal and installation of an
enormous amount of curb and gutter in the Overlay Project area. Keeping the project on schedule and done in time for the Milling Contractor. Attachments
Contract
2018 08 01
Construction Contract
This Contract (“Contract”) is made on the 7th day of May, 2024, between the City of Eden Prairie, Minnesota (hereinafter "City"), whose business address is 8080 Mitchell Road, Eden Prairie, MN 55344, and Curb Masters Inc., a Minnesota Company (hereinafter "Contractor") whose business address is 496 Farwell Ave, South St Paul, MN 55075.
. Preliminary Statement The City has adopted a policy regarding the selection and hiring of contractors to provide a variety of services for City projects. That policy requires that persons, firms or corporations
providing such services enter into written agreements with the City. The purpose of this
Contract is to set forth the terms and conditions for the provision of services by Contractor for removal and replacement of curb and gutter for the Mill and Overlay Project areas hereinafter referred to as the "Work".
The City and Contractor agree as follows: 1. Scope of Work/Proposal. The Contractor agrees to provide, perform and complete all the provisions of the Work in accordance with the Special Provisions Document and attached
Exhibit A.
2. Time of Commencement and Completion. The Work to be performed under this Contract may be commenced immediately after execution of this Contract. The Work shall be completed by July 4th, 2024.
3. Compensation for Services. City agrees to pay the Contractor a cost not to exceed $160,000.00 based on unit prices described in Exhibit A as full and complete payment for the labor, materials and services rendered pursuant to this Contract and as described in the Special Provision Document (Exhibit B).
a. Any changes in the scope of the work which may result in an increase to the compensation due the Contractor shall require prior written approval by an authorized representative of the City or by the City Council. The City will not pay additional compensation for services that do not have prior written authorization.
b. If Contractor is delayed in performance due to any cause beyond its reasonable control, including but not limited to strikes, riots, fires, acts of God, governmental actions, actions of a third party, or actions or inactions of City, the time for performance shall be extended by a period of time lost by reason of the delay.
Contractor will be entitled to payment for its reasonable additional charges, if any,
due to the delay.
Standard Construction Contract 2018 08 01 Page 2 of 19
4. Method of Payment. The Contractor shall submit to the City, on a monthly basis, an itemized invoice for services performed under this Contract. Invoices submitted shall be paid
in the same manner as other claims made to the City.
a. Invoices. Contractor shall verify all statements submitted for payment in compliance with Minnesota Statutes Sections 471.38 and 471.391. For reimbursable expenses, if provided for in Exhibit A, the Contractor shall provide an itemized listing and such
documentation as reasonably required by the City. Each invoice shall contain the
City’s project number and a progress summary showing the original (or amended) amount of the contract, current billing, past payments and unexpended balance of the contract. Each invoice shall be accompanied by general lien waiver and further lien waivers from all subcontractors on the project waiving liens for work for which
payment was requested by Contractor and paid for by City on the preceding invoice.
b. Claims. To receive any payment on this Contract, pursuant to Minn. Stat. 471.38, the invoice or bill must include the following signed and dated statement: “I declare under penalty of perjury that this account, claim, or demand is just and correct and
that no part of it has been paid.” c. Final Payment. Contractor’s request for final payment shall be accompanied by Contractor’s affidavit that all payrolls, bills for materials and equipment, and other indebtedness connected with the Work for which the City or its property might in any
way be responsible, have been paid or otherwise satisfied. Final payment,
constituting the entire unpaid balance of the Contract Sum, shall be paid by the City to the Contractor when the Work has been completed, the Contract fully performed, and the City accepts the Work in writing. The acceptance of final payment shall constitute a waiver of all claims by the Contractor except those previously made in
writing and identified by the Contractor as unsettled at the time of Application for
Final Payment. d. Income Tax Withholding. No final payment shall be made to the Contractor until the Contractor has provided satisfactory evidence to the City that the Contractor and each
of its subcontracts has complied with the provisions of Minn. Stat. Section 290.92
relating to withholding of income taxes upon wages. A certificate by the Commissioner of Revenue shall satisfy this requirement. 5. Standard of Care. Contractor shall exercise the same degree of care, skill and diligence in
the performance of its services as is ordinarily exercised by members of the profession under
similar circumstances in Hennepin County, Minnesota. Contractor shall be liable to the fullest extent permitted under applicable law, without limitation, for any injuries, loss, or damages proximately caused by Contractor's breach of this standard of care. Contractor shall put forth reasonable efforts to complete its duties in a timely manner. Contractor shall not be
responsible for delays caused by factors beyond its control or that could not be reasonably
foreseen at the time of execution of this Contract. Contractor shall be responsible for costs, delays or damages arising from unreasonable delays in the performance of its duties.
Standard Construction Contract 2018 08 01 Page 3 of 19
6. Project Manager and Staffing. The Contractor shall designated a Project Manager and notify the City in writing of the identity of the Project Manager before starting work on the
Project. The Project Manager shall be assisted by other staff members as necessary to
facilitate the completion of the Work in accordance with the terms established herein. Contractor may not remove or replace the Project Manager without the approval of the City. 7. Condition and Inspection. All goods and other materials furnished under this Contract shall
be new and in current manufacture, unless otherwise specified, and all goods and work shall
be of good quality, free from faults and defects and in conformance with this Contract. All goods and work not conforming to these requirements shall be considered defective. Goods shall be subject to inspection and testing by the City. Defective goods or goods not in current manufacture may be returned to the Contractor at the Contractor’s expense.
8. Correction of Work. The Contractor shall promptly correct all Work rejected by the City as defective or as failing to conform under this Contract whether observed before or after completion of the Work and whether or not fabricated, installed or completed. The Contractor shall bear all costs of correcting such rejected Work.
9. Warranty. The Contractor expressly warrants and guarantees to the City that all Work performed and all materials furnished shall be in accord with the Contract and shall be free from defects in materials, workmanship, and operation which appear within a period of one year, or within such longer period as may be prescribed by law or in the terms of the
Contract, from the date of City’s written acceptance of the Work. The City’s rights under the
Contractor’s warranty are not the City’s exclusive remedy. The City shall have all other remedies available under this Contract, at law or in equity. Should any defects develop in the materials, workmanship or operation of the system within
the specified period, upon notice from the City, the Contractor agrees, within ten (10)
calendar days after receiving written notice and without expense to the City, to repair, replace and in general to perform all necessary corrective Work with regard to the defective or nonconforming Work or materials to the satisfaction of the City. THE FOREGOING SHALL NOT IN ANY MANNER LIMIT THE CITY’S REMEDY OR THE CONTRACTOR’S
LIABILITY TO THOSE DEFECTS APPEARING WITHIN THE WARRANTY PERIOD.
The Contractor agrees to perform the Work in a manner and at a time so as to minimize any damages sustained by the City and so as to not interfere with or in any way disrupt the operation of the City or the public.
The corrective Work referred to above shall include without limitation, (a) the cost of
removing the defective or nonconforming Work and materials from the site, (b) the cost of correcting all Work of other Contractors destroyed or damaged by defective or nonconforming Work and materials including the cost of removal of such damaged Work and materials form the site, and (c) the cost of correcting all damages to Work of other
Contractors caused by the removal of the defective or nonconforming Work or materials.
The Contractor shall post bonds to secure the warranties.
Standard Construction Contract 2018 08 01 Page 4 of 19
10. Private Property. The Contractor shall not enter upon private property for any purpose without having previously obtained permission from the City. The Contractor shall be
responsible for the preservation of, and shall use every precaution to prevent damage to all
trees, shrubbery, plants, lawns, fences, culverts, bridges, pavements, driveways, sidewalks, etc.; all water, sewer and gas lines; all conduits; all overhead pole lines or appurtenances thereof; and all other public or private property along or adjacent to the work.
11. Removal of Construction Equipment, Tools and Supplies. At the termination of this
Contract, before acceptance of the Work by the City, the Contractor shall remove all of Contractor’s equipment, tools and supplies from the property of the City. Should the Contractor fail to remove such equipment, tools and supplies, the City shall have the right to remove them and deduct the cost of removal from any amount owed to Contractor.
12. Suspension of Work by City. The City may at any time suspend the Work, or any part thereof, by giving ten (10) days' notice to the Contractor in writing. The work shall be resumed by the Contractor within ten (10) days after the date fixed in the written notice from the City to the Contractor to resume. If the City’s suspension of all or part of the Work causes additional
expenses not due to the fault or negligence of the Contractor, the City shall reimburse the
Contractor for the additional expense incurred due to suspension of the work. Claims for such compensation, with complete substantiating records, shall be filed with the City within ten (10) days after the date of order to resume Work in order to receive consideration. This paragraph shall not be construed as entitling the Contractor to compensation for delays due to inclement
weather, failure to furnish additional surety or sureties specified herein, for suspension made at
the request of the Contractor, or for any other delay provided for in this Contract. 13. City’s Right to Carry Out the Work. If the Contractor defaults or neglects to carry out the Work in accordance with the Contract or fails to perform any provisions of the Contract, the
City may, after ten (10) days written notice to the Contractor and without prejudice to any
other remedy the City may have, make good such deficiencies. In such case an appropriate Change Order shall be issued deducting from the payment then or thereafter due the Contractor the cost of correcting such deficiencies. If the payments then or thereafter due the Contractor are not sufficient to cover such amount, the Contractor shall pay the difference to
the City.
14. City’s Right to Terminate Contract and Complete the Work. The City has the right to terminate this Contract for any of the following reasons: a. The Contractor is adjudged bankrupt, makes a general assignment for the benefit of
creditors, or becomes insolvent;
b. Failure of Contractor to supply adequate properly skilled workmen or proper materials; c. Failure of Contractor to make prompt payment to subcontractor for material or labor;
d. Any disregard of laws, ordinances or proper instructions of the City; e. Assignment or work without permission of the City;
Standard Construction Contract 2018 08 01 Page 5 of 19
f. Abandonment of the work by Contractor;
g. Failure to meet the work progress schedule set forth in this Contract; h. Unnecessary delay which, in the judgment of the City, will result in the work not being completed in the prescribed time.
Termination of the Contract shall be preceded by ten (10) days written notice by the City to the Contractor and its surety stating the grounds for termination and the measures, if any, which must be taken to assure compliance with the Contract. The Contract shall be terminated at the expiration of such ten (10) day period unless the City Council shall withdraw its notice of
termination.
Upon termination of the Contract by the City, the City may, without prejudice to any other remedy the City may have, take possession of the site and of all materials, equipment, tools, construction equipment and machinery thereon owned by the Contractor and may finish the
Work by whatever methods the City may deem expedient at the Contractor’s expense.
Upon Contract termination, the Contractor shall not be entitled to receive any further payment until the Work is finished. If the unpaid balance of the contract price exceeds the expense of finishing the Work, including compensation for additional managerial and administrative
services, the excess shall be paid to the Contractor. If such expense exceeds the unpaid
balance, the Contractor shall pay the difference to the City. In the event that the Contractor abandons the Work, fails or refuses to complete the Work or fails to pay just claims for labor or material, the City reserves the right to charge against the
Contractor all legal, engineering, or other costs resulting from such abandonment, failure or
refusal. Legal costs will include the City's cost of prosecuting or defending any suit in connection with such abandonment, failure or refusal, and non-payment of claims wherein the City is made co-defendant, and the Contractor agrees to pay all costs, including reasonable attorney's fees.
15. Contractor’s Right to Terminate Contract. The Contractor may terminate this Contract upon ten (10) days written notice to the City for any of the following reasons: a. If an order of any court or other public authority caused the Work to be stopped or suspended for a period of 90 days through no act or fault of the Contractor or its
employees.
b. If the City should fail to pay any undisputed sum owed Contractor within forty-five (45) days after the sum becomes due.
16. Subcontractor. The Contractor shall bind every subcontractor and every subcontractor shall agree to be bound by the terms of this Contract as far as applicable to its work, unless specifically noted to the contrary in a subcontract approved in writing as adequate by the City.
Standard Construction Contract 2018 08 01 Page 6 of 19
The Contractor shall pay any subcontractor involved in the performance of this Contract within the ten (10) days of the Contractor's receipt of payment by the City for undisputed
services provided by the subcontractor. If the Contractor fails within that time to pay the
subcontractor any undisputed amount for which the Contractor has received payment by the City, the Contractor shall pay interest to the subcontractor on the unpaid amount at the rate of 1.5 percent per month or any part of a month. The minimum monthly interest penalty payment for an unpaid balance of $100 or more is $10. For an unpaid balance of less than
$100, the Contractor shall pay the actual interest penalty due to the subcontractor. A
subcontractor who prevails in a civil action to collect interest penalties from the Contractor shall be awarded its costs and disbursements, including attorney's fees, incurred in bringing the action.
17. Responsible Contractor
Contractor warrants under oath that Contractor is in compliance with the minimum criteria required of a “responsible contractor” as that term is defined in Minnesota Statutes § 16C.285, subd. 3. Contractor has provided to City a list of all of its first-tier subcontractors and motor carriers that it intends to retain for work on the project. The Contractor has
obtained from all subcontractors and motor carriers with which it will have a direct
contractual relationship a signed statement under oath by an owner or officer verifying that the subcontractor or motor carrier meets all of the minimum criteria in § 16C.285, subd. 3. If Contractor retains additional subcontractors or motor carriers on the project after submitting its verification of compliance, the Contractor shall obtain verification of compliance from
each additional subcontractor and motor carrier with which it has a direct contractual
relationship and shall submit to the City a supplemental verification confirming the subcontractor’s and motor carrier’s compliance with subdivision 3, clause (7), within 14 days of retaining the additional subcontractors or motor carriers. Contractor shall submit to the City upon request copies of the signed verifications of compliance from all subcontractors
and motor carriers of any tier pursuant to Minn. Stat. § 16C.285, subd. 3(7). A false
statement under oath, by Contractor, subcontractor, or motor carrier, verifying compliance with any of the minimum criteria may result in termination of the Contract. 18. Independent Contractor. Contractor is an independent contractor engaged by City to
perform the services described herein and as such (i) shall employ such persons as it shall
deem necessary and appropriate for the performance of its obligations pursuant to this Contract, who shall be employees, and under the direction, of Contractor and in no respect employees of City, and (ii) shall have no authority to employ persons, or make purchases of equipment on behalf of City, or otherwise bind or obligate City. No statement herein shall be
construed so as to find the Contractor an employee of the City.
19. Insurance. a. General Liability. Prior to starting the Work, Contractor shall procure, maintain and pay for such insurance as will protect against claims or loss which may arise out of
operations by Contractor or by any subcontractor or by anyone employed by any of
them or by anyone for whose acts any of them may be liable. Such insurance shall include, but not be limited to, minimum coverages and limits of liability specified in
Standard Construction Contract 2018 08 01 Page 7 of 19
this Paragraph, required by law, or the insurance coverage actually obtained by Contractor, whichever is greater.
b. Contractor shall procure and maintain the following minimum insurance coverages and limits of liability for the Work: Worker’s Compensation Statutory Limits
Employer’s Liability $500,000 each accident $500,000 disease policy limit $500,000 disease each employee
Commercial General $1,000,000 property damage and bodily
Liability injury per occurrence $2,000,000 general aggregate $2,000,000 Products – Completed Operations Aggregate $100,000 fire legal liability each occurrence
$5,000 medical expense
Comprehensive Automobile Liability $1,000,000 combined single limit each accident (shall include coverage for all owned, hired and
non-owed vehicles.)
Umbrella or Excess Liability $1,000,000 c. Commercial General Liability. The Commercial General Liability Policy shall be on
ISO form CG 00 01 12 07 or CG 00 01 04 13, or the equivalent. Such insurance shall
cover liability arising from premises, operations, independent contractors, products-completed operations, personal and advertising injury, and liability assumed under an insured contract (including the tort liability of another assumed in a business contract). There shall be no endorsement or modification of the Commercial General
Liability form arising from pollution, explosion, collapse, underground property
damage or work performed by subcontractors. d. Contractor shall maintain “stop gap” coverage if Contractor obtains Workers’ Compensation coverage from any state fund if Employer’s liability coverage is not
available.
e. All policies, except the Worker’s Compensation Policy, shall name the “City of Eden Prairie” as an additional insured.
f. All policies, except Worker’s Compensation Policy, and Professional Liability Policy,
shall name the “City of Eden Prairie” as an additional insured including products and completed operations.
Standard Construction Contract 2018 08 01 Page 8 of 19
g. All polices shall contain a waiver of subrogation in favor of the City.
h. All General Liability policies, Automobile Liability policies, and Umbrella policies
shall contain a waiver of subrogation in favor of the City. i. All polices, except the Worker’s Compensation Policy, shall insure the defense and indemnity obligations assumed by Contractor under this Contract.
j. Contractor agrees to maintain all coverage required herein throughout the term of the Contract and for a minimum of two (2) years following City’s written acceptance of the Work.
k. It shall be Contractor’s responsibility to pay any retention or deductible for the
coverage’s required herein. l. All policies shall contain a provision or endorsement that coverages afforded thereunder shall not be cancelled or non-renewed or restrictive modifications added,
without thirty (30) days’ prior notice to the City, except that if the cancellation or
non-renewal is due to non-payment, the coverages may not be terminated or non-renewed without ten (10) days’ prior notice to the City. m. Contractor shall maintain in effect all insurance coverages required under this
Paragraph at Contractor’s sole expense and with insurance companies licensed to do
business in the state in Minnesota and having a current A.M. Best rating of no less than A-, unless specifically accepted by City in writing. n. A copy of the Contractor’s Certificate of Insurance which evidences the
compliance with this Paragraph, must be filed with City prior to the start of Contractor’s Work. Upon request a copy of the Contractor’s insurance declaration page, Rider and/or Endorsement, as applicable shall be provided. Such documents evidencing Insurance shall be in a form acceptable to City and shall provide satisfactory evidence that Contractor has complied with all insurance requirements.
Renewal certificates shall be provided to City prior to the expiration date of any of
the required policies. City will not be obligated, however, to review such Certificate of Insurance, declaration page, Rider, Endorsement or certificates or other evidence of insurance, or to advise Contractor of any deficiencies in such documents and receipt thereof shall not relieve Contractor from, nor be deemed a waiver of, City’s
right to enforce the terms of Contractor’s obligations hereunder. City reserves the
right to examine any policy provided for under this paragraph. o. Effect of Contractor’s Failure to Provide Insurance. If Contractor fails to provide the specified insurance, then Contractor will defend, indemnify and hold harmless the City,
the City's officials, agents and employees from any loss, claim, liability and expense
(including reasonable attorney's fees and expenses of litigation) to the extent necessary to afford the same protection as would have been provided by the specified insurance. Except to the extent prohibited by law, this indemnity applies regardless of any strict
Standard Construction Contract 2018 08 01 Page 9 of 19
liability or negligence attributable to the City (including sole negligence) and regardless of the extent to which the underlying occurrence (i.e., the event giving rise to a claim
which would have been covered by the specified insurance) is attributable to the
negligent or otherwise wrongful act or omission (including breach of contract) of Contractor, its subcontractors, agents, employees or delegates. Contractor agrees that this indemnity shall be construed and applied in favor of indemnification. Contractor also agrees that if applicable law limits or precludes any aspect of this indemnity, then
the indemnity will be considered limited only to the extent necessary to comply with
that applicable law. The stated indemnity continues until all applicable statutes of limitation have run. If a claim arises within the scope of the stated indemnity, the City may require
Contractor to:
i. Furnish and pay for a surety bond, satisfactory to the City, guaranteeing performance of the indemnity obligation; or ii. Furnish a written acceptance of tender of defense and indemnity from Contractor's insurance company.
Contractor will take the action required by the City within fifteen (15) days of receiving notice from the City. 20. Indemnification. Contractor will defend and indemnify City, its officers, agents, and
employees and hold them harmless from and against all judgments, claims, damages, costs
and expenses, including a reasonable amount as and for its attorney’s fees paid, incurred or for which it may be liable resulting from any breach of this Contract by Contractor, its agents, contractors and employees, or any negligent or intentional act or omission performed, taken or not performed or taken by Contractor, its agents, contractors and employees, relative
to this Contract. City will indemnify and hold Contractor harmless from and against any loss
for injuries or damages arising out of the negligent acts of the City, its officers, agents or employees. 21. Ownership of Documents. All plans, diagrams, analyses, reports and information generated
in connection with the performance of the Contract (“Information”) shall become the
property of the City, but Contractor may retain copies of such documents as records of the services provided. The City may use the Information for its purposes and the Contractor also may use the Information for its purposes. Use of the Information for the purposes of the project contemplated by this Contract does not relieve any liability on the part of the
Contractor, but any use of the Information by the City or the Contractor beyond the scope of
this Contract is without liability to the other, and the party using the Information agrees to defend and indemnify the other from any claims or liability resulting therefrom. 22. Mediation. Each dispute, claim or controversy arising from or related to this agreement
shall be subject to mediation as a condition precedent to initiating arbitration or legal or
equitable actions by either party. Unless the parties agree otherwise, the mediation shall be in accordance with the Commercial Mediation Procedures of the American Arbitration Association then currently in effect. A request for mediation shall be filed in writing with the
Standard Construction Contract 2018 08 01 Page 10 of 19
American Arbitration Association and the other party. No arbitration or legal or equitable action may be instituted for a period of 90 days from the filing of the request for mediation
unless a longer period of time is provided by agreement of the parties. Cost of mediation
shall be shared equally between the parties. Mediation shall be held in the City of Eden Prairie unless another location is mutually agreed upon by the parties. The parties shall memorialize any agreement resulting from the mediation in a mediated settlement agreement, which agreement shall be enforceable as a settlement in any court having jurisdiction thereof.
GENERAL TERMS AND CONDITIONS
24. Assignment. Neither party shall assign this Contract, nor any interest arising herein,
without the written consent of the other party. 25. Compliance with Laws and Regulations. In providing services hereunder, the Contractor shall abide by statutes, ordinances, rules, and regulations pertaining to the
provisions of services to be provided. Any violation of statutes, ordinances, rules and
regulations pertaining to the services to be provided shall constitute a material breach of this Contract and entitle the City to immediately terminate this Contract. 26. Conflicts. No salaried officer or employee of the City and no member of the Council of
the City shall have a financial interest, direct or indirect, in this Contract. The violation
of this provision renders the Contract void. 27. Counterparts. This Contract may be executed in multiple counterparts, each of which shall be considered an original.
28. Damages. In the event of a breach of this Contract by the City, Contractor shall not be entitled to recover punitive, special or consequential damages or damages for loss of business.
29. Employees. Contractor agrees not to hire any employee or former employee of City and
City agrees not to hire any employee or former employee of Contractor prior to termination of this Contract and for one (1) year thereafter, without prior written consent of the former employer in each case.
30. Enforcement. The Contractor shall reimburse the City for all costs and expenses,
including without limitation, attorneys' fees paid or incurred by the City in connection with the enforcement by the City during the term of this Contract or thereafter of any of the rights or remedies of the City under this Contract.
31. Entire Contract, Construction, Application and Interpretation. This Contract is in
furtherance of the City’s public purpose mission and shall be construed, interpreted, and applied pursuant to and in conformance with the City's public purpose mission. The entire agreement of the parties is contained herein. This Contract supersedes all oral
Standard Construction Contract 2018 08 01 Page 11 of 19
agreements and negotiations between the parties relating to the subject matter hereof as well as any previous agreements presently in effect between the parties relating to the
subject matter hereof. Any alterations, amendments, deletions, or waivers of the
provisions of this Contract shall be valid only when expressed in writing and duly signed by the parties, unless otherwise provided herein. 32. Governing Law. This Contract shall be controlled by the laws of the State of Minnesota.
33. Non-Discrimination. During the performance of this Contract, the Contractor shall not discriminate against any employee or applicants for employment because of race, color, creed, religion, national origin, sex, marital status, status with regard to public assistance, disability, sexual orientation or age. The Contractor shall post in places available to
employees and applicants for employment, notices setting forth the provision of this non-
discrimination clause and stating that all qualified applicants will receive consideration for employment. The Contractor shall incorporate the foregoing requirements of this paragraph in all of its subcontracts for program work, and will require all of its subcontractors for such work to incorporate such requirements in all subcontracts for
program work. The Contractor further agrees to comply with all aspects of the
Minnesota Human Rights Act, Minnesota Statutes 363.01, et. seq., Title VI of the Civil Rights Act of 1964, and the Americans with Disabilities Act of 1990. 34. Notice. Any notice required or permitted to be given by a party upon the other is given in
accordance with this Contract if it is directed to either party by delivering it personally to
an officer of the party, or if mailed in a sealed wrapper by United States registered or certified mail, return receipt requested, postage prepaid, or if deposited cost paid with a nationally recognized, reputable overnight courier, properly addressed to the address listed on page 1 hereof. Notices shall be deemed effective on the earlier of the date of
receipt or the date of mailing or deposit as aforesaid, provided, however, that if notice is
given by mail or deposit, that the time for response to any notice by the other party shall commence to run one business day after any such mailing or deposit. A party may change its address for the service of notice by giving written notice of such change to the other party, in any manner above specified, 10 days prior to the effective date of such
change.
35. Rights and Remedies. The duties and obligations imposed by this Contract and the rights and remedies available thereunder shall be in addition to and not a limitation of any duties, obligations, rights and remedies otherwise imposed or available by law.
36. Services Not Provided For. No claim for services furnished by the Contractor not specifically provided for herein shall be honored by the City. 37. Severability. The provisions of this Contract are severable. If any portion hereof is, for
any reason, held by a court of competent jurisdiction to be contrary to law, such decision
shall not affect the remaining provisions of this Contract. 38. Statutory Provisions.
Standard Construction Contract 2018 08 01 Page 12 of 19
a. Audit Disclosure. The books, records, documents and accounting procedures and practices of the Contractor or other parties relevant to this Contract are subject to
examination by the City and either the Legislative Auditor or the State Auditor for a
period of six (6) years after the effective date of this Contract. b. Data Practices. Any reports, information, or data in any form given to, or prepared or assembled by the Contractor under this Contract which the City requests to
be kept confidential, shall not be made available to any individual or organization without
the City's prior written approval. This Contract is subject to the Minnesota Government Data Practice Act, Minnesota Statutes Chapter 13 (Data Practices Act). All government data, as defined in the Data Practices Act Section 13.02, Subd 7, which is created, collected, received, stored, used, maintained, or disseminated by Contractor in
performing any of the functions of the City during performance of this Contract is subject
to the requirements of the Data Practice Act and Contractor shall comply with those requirements as if it were a government entity. All subcontracts entered into by Contractor in relation to this Contract shall contain similar Data Practices Act compliance language.
39. Waiver. Any waiver by either party of a breach of any provisions of this Contract shall not affect, in any respect, the validity of the remainder of this Contract.
Executed as of the day and year first written above.
CITY OF EDEN PRAIRIE
__________________________________
Mayor ___________________________________ City Manager
CONTRACTOR
By: ________________________________ Its: ________________________________
Standard Construction Contract 2018 08 01 Page 13 of 19
Exhibit A
Standard Construction Contract 2018 08 01 Page 14 of 19
Exhibit B
SPECIAL PROVISIONS FOR
2023 CURB & GUTTER REPLACEMENT
CITY OF EDEN PRAIRIE, MINNESOTA
S-1 SCOPE OF WORK
S-2 START DATE, COMPLETION DATE AND LIQUID
DAMAGES
S-3 PRE-CONSTRUCTION MEETING
S-4 GENERAL CONTRACTOR INFORMATION
S-5 CONSTRUCTION STAKING
S-6 TRAFFIC CONTROL
S-7 EXISTING UTILITIES
S-8 MISCELLANEOUS OBSTRUCTIONS
S-9 IRRIGATION AND PET CONTAINMENT
S-10 PRIVATE PROPERTY
S-11 SITE PROTECTION
S-12 CONCRETE CURB AND GUTTER REMOVAL
S-13 BITUMINOUS PAVEMENT REMOVAL
S-14 CONCRETE CURB AND GUTTER DESIGN
(MOUNTABLE)
S-15 RESTORATION
Standard Construction Contract 2018 08 01 Page 15 of 19
S-1 SCOPE OF WORK
The work to be done under this Contract shall include, but is not
necessarily limited to, furnishing all labor, materials,
transportation, tools, supplies, equipment, etc. necessary to
remove and reconstruct concrete curb and gutter along Round
Lake Rd, Honeysuckle Ln, and Park Cir within the City of Eden
Prairie.
The work under this Contract includes all of the work items as
described in these Specifications and/or shown on the Plans as
prepared by the City of Eden Prairie.
S-2 START DATE, COMPLETION DATE AND LIQUIDATED DAMAGES
Contractor may start work after April 5th, 2023 and must
complete all work required within this contract by June 10,
2022.
Five hundred dollars ($500.00) will be deducted from any money
due the Contractor for each and every calendar day that the
work remains uncompleted beyond the completion date.
S-3 PRE-CONSTRUCTION MEETING
Prior to the start of any work, there will be a
pre-construction meeting required. Representatives of the
City, the Contractor and Subcontractors shall be present at
the meeting.
At this meeting, the contractor shall submit, in writing, to the
City for approval, a schedule which shall essentially indicate
the number of crews to be employed, locations of work for
Standard Construction Contract 2018 08 01 Page 16 of 19
each crew, sequence of construction and completion within
specified contract dates. The contractor must also supply a list
of emergency contacts.
S-4 GENERAL CONTRACTOR INFORMATION
General construction requirements include the following:
a) New concrete curbing shall remain barricaded and
protected for a minimum of three (3) days after
completion.
b) All edges of concrete shall be uniform and straight.
c) Finished surface shall drain properly.
d) The concrete curbing shall be graded in such a
manner as to not create any drainage problems,
i.e., standing water, or ponding along edges. The
contractor shall not change or redirect existing
drainage patterns without authorization and
approval by the City.
S-5 CONSTRUCTION STAKING
For all areas of the project the Contractor is responsible for
constructing the curb and gutter, consistent with the plan and
details and for maintaining existing drainage patterns and
positive drainage flow. The City will work with the contractor to
identify and mark the limits of removal items, and establish
heights if needed.
S-6 TRAFFIC CONTROL
Traffic control shall be the responsibility of the Contractor, which
shall include all flagging, barricades, warning signs and traffic
cones to maintain, control, safeguard vehicle and pedestrian
traffic and the adjacent residents and adequately protect the
work. All traffic control shall be in accordance with the latest
version of the Minnesota Manual on Uniform Traffic Control
Devices (MN MUTCD) as needed. Traffic and access to
properties shall be maintained at all times during
construction. Construction should be staged to allow
Standard Construction Contract 2018 08 01 Page 17 of 19
appropriate pedestrian and bicycle passage through the work
zone.
S-7 EXISTING UTILITIES
It is the Contractor's responsibility to determine and verify the
location of all utilities. The Contractor shall determine the exact
locations as the work proceeds. Excavation work shall be done
carefully so as to avoid damaging the existing utilities. The
Contractor shall determine to what extent any utilities will affect
the work and shall be responsible for their location, protection,
and repair where necessary. It shall be the responsibility of the
Contractor to make the required contacts and coordinate the
work with the utility companies.
S-8 MISCELLANEOUS OBSTRUCTIONS
The Contractor shall provide for protection, temporary
removal and replacement or relocation of obstructions
including but not limited to signs, fences, mailboxes and
landscaping as required for the performance of the work in
these Contract Documents or as directed by the City. After
final grading, all items shall be replaced in their original or new
location and shall be in as good or better condition than when
the job commenced. Existing materials shall be reused where
possible. Coordinate all work with property owners. All work
regarding miscellaneous obstructions shall be incidental to the
contract relocation of obstructions including but not limited to
signs, fences, and mailboxes and landscaping as required for
the performance of the work in these Contract Documents or
as directed by the City. After final grading, all items shall be
replaced in their original or new location and shall be in as
good or better condition than when the job commenced.
Existing materials shall be reused where possible. Coordinate
all work with property owners. All work regarding
miscellaneous obstructions shall be incidental to the contract.
S-9 IRRIGATION AND PET CONTAINMENT SYSTEMS REPAIR
The Contractor shall attempt to field verify existing irrigation
and/or pet containment systems in the project area prior to
construction and notify the City of such known systems. The
Contractor shall avoid or minimize disturbance to existing
Standard Construction Contract 2018 08 01 Page 18 of 19
systems during construction. Irrigation and pet containment
systems damaged by the Contractor shall be repaired to the
satisfaction of the owner by the City, the Contractor may be
liable for costs incurred by the City should damage become
excessive. The Contractor must notify the property owner and
City immediately of damage to pet containment systems so the
property owner is aware that pet containment is not functional
and they can be repaired by the end of the work day.
S-10 PRIVATE PROPERTY
All work as shown shall be performed within the public right of
way or temporary construction easement. If it is necessary or
desirable that the Contractor use land outside of City
right-of-way or easements, the Contractor shall obtain consent
from, and shall execute a written agreement with, the owner
and tenant of the land. The Contractor shall not enter for or
occupy for any purpose, including parking, any private property
outside the designated rights-of-way or easements without
written permission from the owner and tenant.
S-11 SITE PROTECTION
The Contractor shall remove all debris from the roadway at the
end of each workday leaving the roadway in a clean condition in
accordance with the City’s “Erosion Control Policy.” This shall
include excavated materials, sand, etc.
The Contractor shall provide for and be responsible for
protection of existing pavements, driveways, utilities, fencing,
etc. All existing materials, surfaces, etc., which are damaged by
the Contractor outside the construction limits shall be repaired
and restored to an original and functional condition at no cost
to the City. All construction debris, including excavated soils,
shall be removed and disposed of in a manner satisfactory to
the City.
S‐12 CONCRETE CURB AND GUTTER REMOVAL
Concrete curb and gutter removal shall include full depth
removal of concrete curb and gutter as needed to allow for the
construction and restoration of the project. Removal limits
Standard Construction Contract 2018 08 01 Page 19 of 19
shall be verified by the City. The unit price of each item shall
include the curb saw cutting and the removal of the material
off-site. The City will cover cost of rubble disposal at City
designated dump site.
S-13 BITUMINOUS PAVEMENT REMOVAL
Bituminous pavement removal shall include full depth removal
of pavement 12 to 16 inches wide from toe of curb, to form
and install new concrete curb and gutter. Removal limits shall
be verified by the City. The unit price shall include the removal
of the material off-site. The City will cover cost of rubble
disposal at City designated dump site.
S-14 CONCRETE CURB AND GUTTER DESIGN
New concrete curb and gutter shall match existing design and
be installed in accordance with MnDOT 2531 and as shown on
the plans. Payment will be made by the linear foot installed at
the unit bid prices. Transitions shall be paid as linear feet of
curb and gutter at the unit bid price with no additional
compensation allowed. Concrete mix number 3F52 shall be
used for all curb and gutter.
New concrete curb and gutter shall be pinned/doweled to
existing concrete with (2) 12 inch minimum length by ½ inch
diameter epoxy coated dowels, rebar, or tie bars. Pin/dowel
must be centered, embedded a minimum of 6 inches on both
sides of new joint, shall not be closer than 4 inches from the
edge of curb, and a minimum of 10 inches apart.
S-15 RESTORATION
The City of Eden Prairie will be responsible for the restoration
of turf and bituminous adjacent within 12 inches of the curb
and gutter establishment of turf in areas disturbed by
construction. Contractor to limit damage to turf areas behind
the curb.
END OF SECTION
Project Location:Eden Prairie
Project Name:2024 Curb & Gutter Replacement
Project Engineer:City of Eden Prairie
Bids Due:4/25/24 2:00 PM
Submitted By:Matt Busch 952-292-5177
Line Item Quantity Unit Price Extension
1 1 450 LF @ 43.50$ 19,575.00$
2 2 2500 LF @ 45.60$ 114,000.00$
3 3 80 LF @ 74.75$ 5,980.00$
4 0 EA @ 450.00$ -$
139,555.00$
Note:
ACCEPTANCE OF PROPOSAL
The above prices are satisfactory and are hereby accepted.
SIGNATURE: ______________________________________ DATE:_______________________
R&R Concrete Driveway Apron
Catch Basin Set/Adjust
Includes: Bond if Required, Standard Insurance; If Higher Rates, Revised Terms, or Conditions or Special Endorsements Are Required We Reserve The Right To Revise Our Bid To Reflect Such Additional Costs (If Any). Catch
Basin Adjustment up to 2 Rings, Additional Rings $50.00; Rings Furnished By Others, 1 Mobilization(s) additional at
$1800.00 each. Acknowledge Addendum # none.
Does Not Include: No Winter Services, Restoration, Staking, Grade, Base, Backfill, Removals, Traffic Control, Testing,
Permits, Stoops, Steps, Trench Drains, Joint Sealers, Bollards, Signs, Posts, Catch Basin Rings, or Any Other Items
unless listed above.
2024 Work Only
This Proposal may be withdrawn by us if not accepted within 30 days.
Monday, April 29, 2024
Proposal - Revised
Description
R&R 28" Surmountable Curb & Gutter
Bid Items Total:
R&R B618 Curb & Gutter
Curb Masters, Inc.
651-455-5251
496 Farwell Avenue
651-493-3643 Fax
South St Paul, MN 55075
www.CurbMasters.info
Exhibit A
Exhibit B
SPECIAL PROVISIONS FOR
CURB & GUTTER REPLACEMENT
CITY OF EDEN PRAIRIE, MINNESOTA
S-1 SCOPE OF WORK
S-2 START DATE, COMPLETION DATE AND LIQUID DAMAGES
S-3 PRE-CONSTRUCTION MEETING
S-4 GENERAL CONTRACTOR INFORMATION
S-5 CONSTRUCTION STAKING
S-6 TRAFFIC CONTROL
S-7 EXISTING UTILITIES
S-8 MISCELLANEOUS OBSTRUCTIONS
S-9 IRRIGATION AND PET CONTAINMENT
S-10 PRIVATE PROPERTY
S-11 SITE PROTECTION
S-12 CONCRETE CURB AND GUTTER REMOVAL
S-13 BITUMINOUS PAVEMENT REMOVAL
S-14 CONCRETE CURB AND GUTTER DESIGN (MOUNTABLE)
S-15 RESTORATION
S-1 SCOPE OF WORK
The work to be done under this Contract shall include, but is not necessarily limited to,
furnishing all labor, materials, transportation, tools, supplies, equipment, etc. necessary to
remove and reconstruct concrete curb and gutter along Wallace Road, Technology Drive,
Fuller Road, and Venture Lane.
The work under this Contract includes all the work items as described in these
Specifications and/or shown on the Plans as prepared by the City of Eden Prairie.
S-2 START DATE, COMPLETION DATE AND LIQUIDATED DAMAGES
Contractor may start work upon Council approval of the contract and must complete all
work required within this contract by June 22, 2024.
Five hundred dollars ($500.00) will be deducted from any money due the Contractor for each
and every calendar day that the work remains uncompleted beyond the completion date.
S-3 PRE-CONSTRUCTION MEETING
Prior to the start of any work, there will be a pre-construction meeting required.
Representatives of the City, the Contractor and Subcontractors shall be present at the
meeting.
At this meeting, the contractor shall submit, in writing, to the City for approval, a schedule
which shall essentially indicate the number of crews to be employed, locations of work
for each crew, sequence of construction and completion within specified contract dates.
The contractor must also supply a list of emergency contacts.
S-4 GENERAL CONTRACTOR INFORMATION
General construction requirements include the following:
a) New concrete curbing shall remain barricaded and protected for a minimum
of three (3) days after completion.
b) All edges of concrete shall be uniform and straight.
c) Finished surface shall drain properly.
d) The concrete curbing shall be graded in such a manner as to not create any
drainage problems, i.e., standing water, or ponding along edges. The
contractor shall not change or redirect existing drainage patterns without
authorization and approval by the City.
S-5 CONSTRUCTION STAKING
For all areas of the project the Contractor is responsible for constructing the curb and gutter,
consistent with the plan and details and for maintaining existing drainage patterns and
positive drainage flow. The City will work with the contractor to identify and mark the limits
of removal items and establish heights if needed.
S-6 TRAFFIC CONTROL
Traffic control shall be the responsibility of the Contractor, which shall include all flagging,
barricades, warning signs and traffic cones to maintain, control, safeguard vehicle and
pedestrian traffic and the adjacent residents and adequately protect the work. All traffic
control shall be in accordance with the latest version of the Minnesota Manual on Uniform
Traffic Control Devices (MN MUTCD) as needed. Traffic and access to properties shall be
maintained at all times during construction. Construction should be staged to allow
appropriate pedestrian and bicycle passage through the work zone.
S-7 EXISTING UTILITIES
It is the Contractor's responsibility to determine and verify the location of all utilities. The
Contractor shall determine the exact locations as the work proceeds. Excavation work shall
be done carefully to avoid damaging the existing utilities. The Contractor shall determine to
what extent any utilities will affect the work and shall be responsible for their location,
protection, and repair where necessary. It shall be the responsibility of the Contractor to
make the required contacts and coordinate the work with the utility companies.
S-8 MISCELLANEOUS OBSTRUCTIONS
The Contractor shall provide for protection, temporary removal and replacement or
relocation of obstructions including but not limited to signs, fences, mailboxes, and
landscaping as required for the performance of the work in these Contract Documents or
as directed by the City. After final grading, all items shall be replaced in their original or
new location and shall be in as good or better condition than when the job commenced.
Existing materials shall be reused where possible. Coordinate all work with property
owners. All work regarding miscellaneous obstructions shall be incidental to the contract
relocation of obstructions including but not limited to signs, fences, and mailboxes and
landscaping as required for the performance of the work in these Contract Documents or
as directed by the City. After final grading, all items shall be replaced in their original or
new location and shall be in as good or better condition than when the job commenced.
Existing materials shall be reused where possible. Coordinate all work with property
owners. All work regarding miscellaneous obstructions shall be incidental to the contract.
S-9 IRRIGATION AND PET CONTAINMENT SYSTEMS REPAIR
The Contractor shall attempt to field verify existing irrigation and/or pet containment
systems in the project area prior to construction and notify the City of such known systems.
The Contractor shall avoid or minimize disturbance to existing systems during construction.
Irrigation and pet containment systems damaged by the Contractor shall be repaired to the
satisfaction of the owner by the City, the Contractor may be liable for costs incurred by
the City should damage become excessive. The Contractor must notify the property
owner and City immediately of damage to pet containment systems so the property
owner is aware that pet containment is not functional and they can be repaired by the end
of the work day.
S-10 PRIVATE PROPERTY
All work as shown shall be performed within the public right of way or temporary
construction easement. If it is necessary or desirable that the Contractor use land outside of
City right-of-way or easements, the Contractor shall obtain consent from, and shall execute
a written agreement with, the owner and tenant of the land. The Contractor shall not enter
for or occupy for any purpose, including parking, any private property outside the designated
rights-of-way or easements without written permission from the owner and tenant.
S-11 SITE PROTECTION
The Contractor shall remove all debris from the roadway at the end of each workday leaving
the roadway in a clean condition in accordance with the City’s “Erosion Control Policy.” This
shall include excavated materials, sand, etc.
The Contractor shall provide for and be responsible for protection of existing pavements,
driveways, utilities, fencing, etc. All existing materials, surfaces, etc., which are damaged
by the Contractor outside the construction limits shall be repaired and restored to an
original and functional condition at no cost to the City. All construction debris, including
excavated soils, shall be removed, and disposed of in a manner satisfactory to the City.
S‐12 CONCRETE CURB AND GUTTER REMOVAL
Concrete curb and gutter removal shall include full depth removal of concrete curb and
gutter as needed to allow for the construction and restoration of the project. Removal
limits shall be verified by the City. The unit price of each item shall include the curb saw
cutting and the removal of the material off-site. The City will cover the cost of rubble
disposal at a City designated dump site.
S-13 BITUMINOUS PAVEMENT REMOVAL
Bituminous pavement removal shall include full depth removal of pavement 12 to 16
inches wide from toe of curb, to form and install new concrete curb and gutter. Removal
limits shall be verified by the City. The unit price shall include the removal of the material
off-site. The City will cover the cost of rubble disposal at a City designated dump site.
S-14 CONCRETE CURB AND GUTTER DESIGN
New concrete curb and gutter shall match existing design and be installed in accordance
with MnDOT 2531 and as shown on the plans. Payment will be made by the linear foot
installed at the unit bid prices. Transitions shall be paid as linear feet of curb and gutter
at the unit bid price with no additional compensation allowed. Concrete mix number 3F52
shall be used for all curb and gutter.
New concrete curb and gutter shall be pinned/doweled to existing concrete with (2) 12
inch minimum length by ½ inch diameter epoxy coated dowels, rebar, or tie bars.
Pin/dowel must be centered, embedded a minimum of 6 inches on both sides of new
joint, shall not be closer than 4 inches from the edge of curb, and a minimum of 10 inches
apart.
S-15 RESTORATION
The City of Eden Prairie will be responsible for the restoration of turf and bituminous
adjacent within 12 inches of the curb and gutter establishment of turf in areas disturbed
by construction. Contractor to limit damage to turf areas behind the curb.
END OF SECTION
Requested Action
Move to:
• Close the Public Hearing; and
• Adopt a Resolution for Planned Unit Development Concept Review on 6.43 acres; and
• Approve the 1st Reading of an Ordinance for Planned Unit Development District Review with waivers and Zoning Change from Rural to R1-9.5 on 6.43 acres; and
• Adopt a Resolution for a Preliminary Plat of one parcel into 17 lots and 1 outlot on 6.43 acres; and
• Adopt a Resolution for the Findings of Fact in Support of Park Dedication Fees; and
• Direct Staff to prepare a Development Agreement incorporating Staff and Commission
recommendations and Council conditions; and
• Authorize the issuance of an early Land Alteration Permit for Enclave at Manor Road at the request of the Developer subject to the conditions outlined in the permit.
Synopsis
The applicant is requesting approval to divide one parcel into 17 single family lots and one (1) outlot. The 6.43-acre property is located at 6591 168th Avenue West, which is about a quarter mile north of
Duck Lake. The subject parcel, surrounded by existing single-family homes, is designated as an infill
site in the Comprehensive Plan. The project includes a road and sidewalk connection between South Manor Road and West 168th Avenue. The proposed density is 2.64 units per acre, which is consistent with the Low-Density residential guiding. The current zoning is Rural and the applicant is requesting a zoning district change to R1-9.5. A PUD is also being requested with three (3) waivers related to front
yard setback and minimum lot width. The proposed outlot includes a stormwater basin that would be
owned and maintained by the City. Planning Commission
A public hearing for this item was held at the April 8, 2024, Planning Commission meeting. The most common concern raised by residents was the potential traffic impacts of this development. Staff
discussed how this area historically has not been known to have speeding problems and reiterated the
conclusions of the traffic study that the area roads would adequately serve the modest added traffic. Some residents also had questions about construction traffic. The applicant stated that there will be a dedicated person on site during construction that will be able to address any concerns raised by
residents.
CITY COUNCIL AGENDA
SECTION: Public Hearings
DATE
May 7, 2024
DEPARTMENT / DIVISION: Community Development/Planning Julie Klima/Ben Schneider
ITEM DESCRIPTION
Enclave at Manor Road
ITEM NO.
IX.A.
There was also a concern raised about existing drainage issues in the area. The neighborhood of concern, due to its age, has minimal stormwater infrastructure, and the added stormwater management will
improve these conditions.
The Planning Commission expressed support for the project and ultimately voted 8-0 to recommend approval.
The attached Planning Commission staff report provides more details regarding requested waivers, lot
configuration, traffic, and tree removal/replacement.
Attachments
1. Resolution for PUD Concept Review
2. Ordinance for PUD District Review with waivers and Zoning Change 3. Resolution for Preliminary Plat 4. Resolution for the Findings of Fact in Support of Park Dedication Fees 5. Planning Commission Staff Report
6. Planning Commission Unapproved Minutes dated April 8, 2024
7. Public Comments
CITY OF EDEN PRAIRIE
HENNEPIN COUNTY, MINNESOTA RESOLUTION NO. 2024-___ A RESOLUTION APPROVING THE PLANNED UNIT DEVELOPMENT
CONCEPT OF ENCLAVE AT MANOR ROAD FOR ENCLAVE AT MANOR ROAD, LLC.
WHEREAS, the City of Eden Prairie has by virtue of City Code provided for the
Planned Unit Development (PUD) Concept of certain areas located within the City; and
WHEREAS, the Planning Commission did conduct a public hearing on April 8, 2024, on Enclave at Manor Road by Enclave at Manor Road, LLC and considered the request for approval of the PUD Concept Plan and recommended approval of the request to the City
Council; and
WHEREAS, the City Council did consider the request on May 7, 2024. NOW, THEREFORE, BE IT RESOLVED by the City Council of Eden Prairie,
Minnesota, as follows:
1. Enclave at Manor Road, being in Hennepin County, Minnesota, legally described as outlined in Exhibit A, is attached hereto and made a part hereof (“Property”).
2. That the City Council does grant PUD Concept approval as outlined in the plans
stamp dated April 28, 2024. 3. That the PUD Concept meets the recommendations of the Planning Commission dated April 8, 2024.
ADOPTED by the City Council of the City of Eden Prairie this 7th day of May, 2024. _________________________
Ronald A. Case, Mayor ATTEST: _________________________
David Teigland, City Clerk
EXHIBIT A
Legal Description Prior to Final Plat
The South 420.0 feet of the West ½ of the Southwest Quarter of the Northeast Quarter of Section 5, Township 116, Range 22 except the West 30.0 feet thereof, Hennepin County,
Minnesota
Legal Description After the Final Plat
Lots 1-17 and Outlot A, Enclave at Manor Road, Hennepin County, Minnesota
ENCLAVE AT MANOR ROAD
CITY OF EDEN PRAIRIE HENNEPIN COUNTY, MINNESOTA ORDINANCE NO. -2024
AN ORDINANCE OF THE CITY OF EDEN PRAIRIE, MINNESOTA, REMOVING CERTAIN LAND FROM ONE ZONING DISTRICT AND PLACING IT IN ANOTHER, AMENDING THE LEGAL DESCRIPTIONS OF LAND IN EACH DISTRICT, AMENDING THE DESIGNATION OF CERTAIN LAND WITHIN A ZONING
DISTRICT, AND ADOPTING BY REFERENCE CITY CODE CHAPTER 11 AND SECTION 11.99 WHICH, AMONG OTHER THINGS, CONTAIN PENALTY PROVISIONS THE CITY COUNCIL OF THE CITY OF EDEN PRAIRIE, MINNESOTA, ORDAINS:
Section 1. That the land which is the subject of this Ordinance (hereinafter, the “land”) is legally described in Exhibit A attached hereto and made a part hereof. Section 2. That action was duly initiated proposing that the land be removed from
the Rural Zoning District and be placed in the R1-9.5 Zoning District.
Section 3. That action was duly initiated proposing that the designation of the land be amended within the R1-9.5 Zoning District as -2024-PUD-_-2024 (hereinafter "PUD-_-2024”).
Section 4. The City Council hereby makes the following findings:
A. PUD-_-2024 is not in conflict with the goals of the Comprehensive Guide Plan of the City.
B. PUD-_-2024 is designed in such a manner to form a desirable and unified
environment within its own boundaries. C. The exceptions to the standard requirements of Chapters 11 and 12 of the City Code that are contained in PUD-_-2024 are justified by the design of the
development described therein.
D. PUD-_-2024 is of sufficient size, composition, and arrangement that its construction, marketing, and operation are feasible as a complete unit without dependence upon any subsequent unit.
Section 5. The proposal is hereby adopted and the land shall be, and hereby is removed from the Rural Zoning District and placed in the R1-9.5 Zoning District, as noted in Exhibit A and shall be included hereafter in the Planned Unit Development PUD-_-2024 and the legal descriptions of land in each district referred to in City Code Section 11.03 shall be and are
amended accordingly.
Section 6. The land shall be subject to the terms and conditions of that certain Development Agreement dated entered into between ___________, and the City of
Eden Prairie, (hereinafter “Development Agreement”). The Development Agreement contains the terms and conditions of PUD-_-2024, and are hereby made a part hereof.
Section 7. City Code Chapter 1 entitled “General Provisions and Definitions Applicable to the Entire City Code Including Penalty for Violation” and Section 11.99 entitled “Violation a Misdemeanor” are hereby adopted in their entirety by reference, as though repeated verbatim herein.
Section 8. The City Council determines that publication of the title and a summary of this
ordinance clearly informs the public of the intent and effect of the ordinance, and directs that only the title of the ordinance and a summary attached as Exhibit B hereto be published, with notice that a printed copy of the ordinance is available for inspection by any person during regular business hours at the office of the city clerk.
Section 9. This Ordinance shall become effective from and after its passage and publication. FIRST READ at a regular meeting of the City Council of the City of Eden Prairie on the May 7, 2024, and finally read and adopted and ordered published in summary form as
attached hereto at a regular meeting of the City Council of said City on the ____ day of
________, 2024.
ATTEST: ___________________________ _____________________________
David Teigland, City Clerk Ronald A. Case, Mayor
PUBLISHED in the Sun Sailor on__________________, 2024.
EXHIBIT A
Legal Description Prior to Final Plat
The South 420.0 feet of the West ½ of the Southwest Quarter of the Northeast Quarter of Section 5, Township 116, Range 22 except the West 30.0 feet thereof, Hennepin County, Minnesota
Legal Description After the Final Plat
Lots 1-17 and Outlot A, Enclave at Manor Road, Hennepin County, Minnesota
CITY OF EDEN PRAIRIE HENNEPIN COUNTY, MINNESOTA
RESOLUTION NO. 2024-___ RESOLUTION APPROVING THE PRELIMINARY PLAT OF ENCLAVE AT MANOR ROAD FOR ENCLAVE AT MANOR ROAD, LLC
BE IT RESOLVED, by the Eden Prairie City Council as follows: That the preliminary plat of Enclave at Manor Road for Enclave at Manor Road, LLC dated
March 12, 2024, and consisting of 6.43 acres into 17 lots and 1 outlot, a copy of which is on file
at the City Hall, is found to be in conformance with the provisions of the Eden Prairie Zoning and Platting ordinances, and amendments thereto, and is herein approved subject to approval of the 2nd reading of the Ordinance for Planned Development District Review with waivers and a Zoning District change and approval of the Development Agreement. ADOPTED by the Eden Prairie City Council on the 7th day of May, 2024. ___________________________
Ronald A. Case, Mayor ATTEST:
___________________________ David Teigland, City Clerk
CITY OF EDEN PRAIRIE HENNEPIN COUNTY, MINNESOTA
RESOLUTION NO. 2024-____ A RESOLUTION ADOPTING FINDINGS OF FACT IN SUPPORT OF PARK DEDICATION FEES FOR ENCLAVE AT MANOR ROAD WHEREAS, City Code Chapter 12, Section 12.40 Subd. 1 requires an owner of land being subdivided to dedicate to the public for public use as parks, playgrounds or public open space a reasonable portion of the land up to 10% thereof; and,
WHEREAS, in lieu of dedicating land, City Code Chapter 12, Section 12.40 Subd. 2; gives the City the option to require the developer to contribute an equivalent amount in cash in lieu of all or a portion of the land which the City may require such owner to dedicate in accordance with the schedule to be set by resolution of the Council;
WHEREAS, the Enclave at Manor Road project includes subdivision of property pursuant to City Code Chapter 12 into 17 single-family lots and 1 outlot (the “Project”); WHEREAS the payment of cash park fees in lieu of land dedication is appropriate given the nature of the use on the property;
WHEREAS, the City’s current fee ordinance sets the cash park fee at $6,500 per residential unit, which amount was calculated in accordance with Minn. Stat. § 462.358, subd. 2b(c);
WHEREAS, the City Council held a public hearing at its May 7, 2024 meeting;
NOW, THEREFORE, BE IT HEREBY RESOLVED BY THE CITY COUNCIL OF THE CITY OF EDEN PRAIRIE, that the following findings are hereby adopted in support of
the imposition of a cash park fee in lieu of land dedication as a condition of subdivision approval for the Enclave at Manor Road project:
1. The Project does not include available land that is suitable for parkland.
2. The Project includes the construction of 17 single-family homes. Development and
occupancy of the units is expected to have an impact on the City’s parks and trail system.
3. The Project is connected to a public sidewalk system providing access to a public trail along Duck Lake Trail and to parks and open spaces, increasing the likelihood that residents of the Project will use the City’s trails, parks, and open spaces.
4. The City has sidewalks and trails throughout the neighborhood. The City improves and
maintains the pedestrian and bicycle facilities for all residents to enjoy.
5. There is an essential nexus between requiring the cash park fees for the Project and the City’s goal of providing a high-quality park system for all individuals who live or work in
the City, including residents of the Project.
6. The need for parkland created by the Project is roughly proportional to the cash park fee amount required by the City’s fee ordinance. The cash park fees will be used for future anticipated park acquisition and improvement projects in the City, pedestrian and bicycle facility improvements, and other projects to improve City park and recreational facilities
that are likely to be used by residents of the Project.
ADOPTED by the City Council of the City of Eden Prairie this 7th day of May, 2024.
___________________________
Ronald A. Case, Mayor
ATTEST:
___________________________
David Teigland, City Clerk
TO: Planning Commission
FROM: Ben Schneider, Planner I
DATE: April 8, 2024 SUBJECT: Enclave at Manor Road
LOCATION: 6591 168th Avenue West REQUEST: • PUD Concept Plan Review on 6.43 acres
• PUD District Review with waivers on 6.43 acres
• Zoning Change from Rural to R1-9.5 on 6.43 acres
• Preliminary Plat to divide one parcel into 17 lots and 1 outlot on 6.43
acres
BACKGROUND The applicant is
requesting approval to subdivide the property into 17 single family lots at 6591 168th
Avenue West. The
property is located about a quarter mile north of Duck Lake, on the east side of 168th
Avenue West.
The project site includes one parcel with a house, barn
structure, and silo (all
vacant). The property is surrounded by single-family homes. The topography is
mostly flat, although the grades begin to slope downward on the northern edge of the site. There are several trees dispersed throughout the area.
Staff Report – Enclave at Manor Road
April 8, 2024 Page 2
2
COMPREHENSIVE PLAN AND ZONING The subject property is identified as an infill site in the Comprehensive Plan and is guided for low density residential, which allows up to five (5) units per acre. The proposed development is 2.64 units per acre.
The property is currently zoned Rural. The applicant is requesting to rezone the property to R1-9.5, which is consistent with the Comprehensive Plan and neighboring homes along South Manor Road to the east. There are also lots zoned R1-13.5 to the north and south and homes zoned R1-22 to the west. PRELIMINARY PLAT The preliminary plat divides the existing parcel into 17 lots and one (1) outlot for a stormwater basin. The plat is bisected by right of way for the proposed connection of South Manor Road to 168th Avenue West. The northern half includes eight (8) lots that are 65 feet wide and Outlot A. These eight (8) lots would require a waiver from the standard lot width of 70 feet. The southern half
features nine (9) lots ranging from 72 feet to 85 feet in width, meeting the lot width standard.
Staff Report – Enclave at Manor Road
April 8, 2024 Page 3
3
The plat includes a 20-foot drainage and utility easement that runs through lots 1-7 to the north and an extra five (5) feet of side yard easements for six (6) of the southern lots. The goal of this
configuration of easements and associated stormwater piping is to maximize tree preservation and tree replacement opportunities. PLAN ITERATIONS The initial plans that were submitted to the City showed 20 lots instead of 17 lots, with 10 lots on
each side of South Manor Road. Outlot A and the associated stormwater basin was proposed to abut the rear yards of six (6) lots, which would have required lot size waivers. Earlier plans also showed a stormwater sewer line that encompassed most of the southern and western edges of the site. This resulted in more tree removals and less opportunities for tree replacement. Finally, the stormwater BMP posed maintenance and aesthetic concerns by staff. The resulting proposal minimizes waivers
and addresses landscaping and tree preservation goals of the city. PLANNED UNIT DEVELOPMENT WAIVERS The purpose of a Planned Unit Development (PUD) as stated in the City Code is to provide for a more creative and efficient approach to the use of land within the City; to allow variety in the
types of environment available to people and distribution of overall density of population and intensity of land use where desirable and feasible; and provide for greater creativity and flexibility in environmental design. The applicant is requesting the following waivers from City Code:
1. Front Yard Setback along South Manor Road. The request is to have a front yard setback of 25 feet along South Manor Road. City Code requires 30 feet. This waiver, applied to all lots, is supported by staff because the reduced setback will help preserve trees in the rear yards, along the periphery of the site. This will also provide more space
for future rear yard improvements, including decks, sheds, and pools.
2. Front Yard Setback along 168th Avenue West. The applicant is requesting a 20-foot front yard setback along 168th Avenue West. City Code requires a 30-foot setback on both sides of a corner lot that face a street. This will only impact Lot 1, Block 2 on the southwest corner of the plat. This setback is being requested in exchange for the wider
easements that are needed on some of the lots on Block 2. As mentioned previously, this
configuration of easements promotes the most tree preservation and tree replacement opportunities on the site. The planting plan also includes six (6) coniferous trees to screen this future home from 168th Avenue West. Staff supports this waiver request. 3. Minimum Lot Width. The applicant is requesting a minimum lot width of 65 feet for lots 1-8 on Block 1. City Code requires a minimum lot width of 70 feet in the R1-9.5 District.
The following are rationale for supporting this waiver: a. The developer is protecting over 40 significant trees, including one of the two heritage trees, along the periphery of the site. This will help provide some immediate screening with mature trees.
b. There are several lots in the adjacent neighborhood to the east with lot widths
Staff Report – Enclave at Manor Road
April 8, 2024 Page 4
4
under 70 feet. The closest nine (9) homes on the south side of the road range from about 65 feet to 69 feet width. Further down South Manor Road (closer to Duck
Lake Trail) are lots that are closer to 55 feet wide. Overall, this waiver request does not alter neighborhood character. c. The lots requesting the width waiver exceed the minimum lot size and lot depth for the district. d. The waiver request is for the lots on the same side of the road as Outlot A. The
initial application submittal showed three extra lots in the location of this outlot. The developer has worked with staff to reduce the number of lots and reconfigure the plat to better fit the overall neighborhood. TRAFFIC AND ACCESS
Staff has requested that the developer include the road connection between South Manor Road and 168th Avenue South. Staff supports this connection for the following reasons: 1. Initial Plans. This connection was anticipated at the time the adjacent neighborhood to the east was approved in 1983. The staff report stated the following: “The access road off
Duck Lake Trail, as it turns to the west through Phase II, should be extended to the west
property. This will eventually provide a connection the adjoining neighborhood.” The “access road” refers to South Manor Road and “Phase II” refers to the current neighborhood adjacent to the east. 2. Comprehensive Plan. This road connection is included as one of the “Anticipated Roadway Connections” in Aspire 2040.
3. Traffic Study. A full traffic study memo was produced for this project. The analysis is based off the initial 20 lot proposal, three more than what is now proposed. The memo concludes that the traffic levels would be acceptable with this new development and the associated road connection at W 168th/ S Manor Rd, W 168th/ Duck Lake Trail, and S Manor Rd/ Duck Lake Trail. It is estimated that 20 new homes would generate an
additional 15 trips during the AM peak hour and 19 trips in the PM peak hour. 4. Connectivity. As noted in City Code, cul de sacs should be avoided whenever reasonably possible. A connection here promotes community, safety, and provides for more efficient street maintenance, including snow removal. SIDEWALKS There are existing sidewalks along 168th Avenue West and on the north side of South Manor Road. The developer is proposing to continue the South Manor Road sidewalk and connect it to 168th Avenue West.
TREE LOSS AND REPLACEMENT
The site has 2,723 caliper inches of significant trees, including two heritage trees. A total of 2,068 caliper inches, or about 75 percent, are proposed to be removed. This includes one of the two heritage trees. The trees that are being preserved are mostly along the periphery of the site, which
Staff Report – Enclave at Manor Road
April 8, 2024 Page 5
5
will assist with screening the development from surrounding neighborhoods.
Based on the removal plans, the developer owes 830 caliper inches of replacement trees. The planting plan shows 599 inches being added, meaning cash in lieu payment will be needed for the remaining 231 inches owed, meeting City Code requirements. Trees are planted along the edges of the site, around the stormwater basin, and in the front and rear yards of each lot. STORMWATER MANAGEMENT Based on the slope of the land, all stormwater is proposed to flow to a stormwater filtration basin in the northwest corner of the development. This basin provides rate control for stormwater discharges from the site and removes pollutants. The basin would be in an outlot and maintained by the City. The basin would discharge to an existing trunk storm sewer north of the site, a portion of which is
proposed to be upsized. This portion is within a drainage and utility easement along the western edges of 6537 168th Ave West and 16460 North Manor Road. The developer has been in communication with these property owners, as the work would result in a temporary disturbance of their yards and driveway.
The planting plan shows several new trees that would surround the basin area to provide screening as well as an access for City maintenance of the basin. HOUSING PRODUCT The submittal includes
examples of homes that Brandl Anderson plans to build in this development. Their products feature a variety of rooflines and all include three-car
garages. In contrast to other recent infill single-family projects in the City, the garages of these homes tend to be more flush with the rest of the front
home façade. The applicant estimates that the starting price point for these homes would be around $700,000. There is no HOA planned for this development.
NEIGHBORHOOD MEETING The developer held a neighborhood meeting during the evening of Wednesday, March 27. About 30 people were in attendance. Staff has also received some email comments, which have been included
“The Edgestone”
Staff Report – Enclave at Manor Road
April 8, 2024 Page 6
6
in this packet. Here is a summary of the comments that were shared by the neighbors regarding the proposed development:
• Road connection. Some residents expressed opposition to the road connection between the proposed development and South Manor Road to the east due to traffic concerns. Staff supports this road connection for the reasons cited above in the “Traffic and Access” section.
• Stormwater Ponding. The residents have some aesthetic concerns with the proposed location
of the stormwater basin and request that the ponding be adequately screened. Current plans do show new trees surrounding the basin. Although, some openings would be necessary to provide proper maintenance access.
• Sidwalk Maintenance. The neighborhood shared that the portion of the existing sidewalk
that abuts the subject property on 168th Avenue West has not been plowed, at least this past
winter. In general, adjacent property owners are responsible for sidewalk snow removal. If the site were to be developed as proposed, the responsibility of snow removal of this sidewalk would be shared by the City (northern half that abuts Outlot A) and the future owner of Lot 1, Block 2 (southern half).
• Construction Traffic. Residents had general concerns about construction traffic concerning this development and at High Trail Estates Park, which is west of the project site. The City is planning to replace the play equipment at the park, but this work is not anticipated to interfere with other construction traffic.
SUSTAINABILITY STANDARD Since this is project is a Planned Unit Development, it triggers the City’s new sustainable building standard that has been in effect since January 1, 2024. For this project, all homes will be required to install at least one EV-Ready parking space (garage charger) and build a roof that meets Solar-Ready
guidelines.
Brandl Anderson also states in their narrative that each home will have energy star rating appliances, low VOC materials, and tankless water heaters.
STAFF RECOMMENDATION Recommend approval of the following requests:
• PUD Concept Plan Review on 6.43 acres
• PUD District Review with waivers on 6.43 acres
• Zoning Change from Rural to R1-9.5 on 6.43 acres
• Preliminary Plat to divide one parcel into 17 lots and 1 outlot on 6.43 acres This is based on plans submitted on April 4, 2024, staff report dated April 8, 2024, and the following conditions:
Staff Report – Enclave at Manor Road
April 8, 2024 Page 7
7
1. Prior to release of the Final Plat, the applicant shall A. Sign special assessment agreement for City trunk sewer and water assessment fees and connection fees.
B. Pay the proportioned cost of future roadway improvements along 168th Ave.
C. Submit detailed storm water runoff, utility and erosion control plans for review by the
City Engineer and Watershed District.
D. Tender a warranty deed for Outlot A for review and written approval by the City Engineer. After approval of the warranty deed and filing of the final plat, file the warranty deed with Hennepin County. E. Submit a bond, letter of credit, or cash deposit (“security”) that guarantees completion of all public improvements equivalent to 125% of the cost of the
improvements.
2. Prior to land alteration permit issuance, the applicant shall:
A. Submit detailed storm water runoff, wetland, utility, street and erosion control plans for review and approval by the City Engineer. B. Pay the fee in lieu for tree replacement.
C. Submit a landscaping letter of credit or escrow surety equivalent to 150% of the cost of the tree replacement. D. Obtain and provide documentation of Watershed District approval.
E. Notify the City and Watershed District 48 hours in advance of grading. F. Install erosion control at the grading limits of the property for review and approval by the City.
G. Submit a land alteration bond, letter of credit, or escrow surety equivalent to 125% of
the cost of the land alteration.
3. Prior to building permit issuance for the lots, the applicant shall:
A. Pay the appropriate cash park fee.
B. Provide recorded copy of the warranty deed for Outlot A to the City following recording of the final plat.
C. Submit construction plans and project specifications for public infrastructure for review and approval by the City Engineer.
UNAPPROVED MINUTES
EDEN PRAIRIE PLANNING COMMISSION
MONDAY, APRIL 8, 2024 7:00 PM—CITY CENTER Council Chambers 8080 Mitchell Road
COMMISSION MEMBERS: John Kirk, Frank Sherwood, Andrew Pieper, Ed Farr, Trisha Duncan, Robert Taylor, Dan Grote, Charles Weber; Phou Sivilay CITY STAFF: Jeremy Barnhart, City Planner; Carter Schulze, City Engineer; Matt Bourne, Manager of Parks and Natural Resources; Kristin Harley, Recording Secretary I. CALL THE MEETING TO ORDER Chair Pieper called the meeting to order at 7:00 p.m.
II. PLEDGE OF ALLEGIANCE – ROLL CALL
Chuck Weber was absent. Chair Pieper welcomed new commission member Trisha
Duncan. III. APPROVAL OF AGENDA
MOTION: Kirk moved, seconded by Taylor to approve the agenda. MOTION
CARRIED 8-0.
IV. MINUTES
MOTION: Sherwood moved, seconded by Kirk to approve the minutes of February 12,
2023 with the change from “used access agreement” to “shared access agreement” on
Item V, page 2, paragraph four. MOTION CARRIED 8-0.
V. PUBLIC HEARINGS
A. ENCLAVE AT MANOR ROAD (2023-14) Request for
• PUD Concept Review of 6.43 acres
• PUD District Review with waivers on 6.43 acres
• Zoning Change from Rural to R1-9.5 on 6.43 acres
PLANNING COMMISSION MINUTES April 8, 2024
Page 2
• Preliminary Plat to divide one parcel into 17 lots and one outlot on 6.43 acres Chris Contreras, President of Brandl Anderson Homes displayed a PowerPoint and detailed the application. He introduced his company and described the setback waiver to conserve more of the trees. The development would create 17
lots and one outlot. The landscape plan utilized a tree replacement formula replacing as many as possible, and also to fill in with plantings as many as possible. The timeframe anticipates completion in June 2024, with sales in August-September and the last home and escrow completed by April 2026. The houses would range from 2,400 to 4,000 square feet and be priced in the Low
700s. They would have stone accents, increased roof pitches, smart siding instead of vinyl and would be EV and solar ready. The developer could offer one-level homes but the target buyer was two-story homes. Barnhart presented the staff report. This was a subdivision with a right-of-way
and an outlot for stormwater management on the northwest corner of the site. The lots were orientated on the extension of South Manor Road. This was a redevelopment of an existing farm which was not historic, but would nevertheless be documented by the Heritage Preservation Commission. A waiver requested a front yard setback reduction from 30 to 25, and the front yard along 168th would
be reduced to 20 feet. Along the north side of the road the lot width would be reduced from 70 feet to 65 feet. Staff supported these waivers to manage and maintain existing vegetation. They allowed more space in backyards away from grading and vegetation. The project would try to design around existing vegetation and stormwater treatment, and it was a challenge because of the soils
and slope. The corner outlot was best case scenario of the available option. The developer had a tree replacement plan and screening plan. Staff recommended approval subject to the conditions in the staff report. Ted Mellbey of 11881 Germaine Terrace questioned why no commission
members had any questions of the developer. He asked if they had visited the site and stated he would circulate a photograph of the tree removal at Pioneer Trail and Dell Road. He hoped the photograph would move the commissioners to leave as many trees as possible. He stated could not understand the tree replacement formula and would be meeting with City staff regarding his concerns.
Adam Driscoll of 6411 Mere Drive stated he respected the rights of the building and property owners but urged the commission members to consider noise and traffic during the construction phase. He asked for hours of operation and contacts to limit noise and disturbance. He stated there had been numerous near-misses in
the neighborhood and requested that construction related traffic use the west side of the development.
PLANNING COMMISSION MINUTES April 8, 2024
Page 3
Patty Farris stated she lived on 168th adjacent to the outlot and this development
would ruin the salability of her house along with the views she enjoyed. It would
create an island with just her house on the side. A pipe would be put through her yard tearing up her driveway and she had no assurances of repair. Many of the trees saved would be buckthorn and box elder junk trees. She pleaded for a pause on the development for this month so she could ask the developers for an
alternative plan with the outlot in the subdivision itself. She invited the
commission members to visit her and visit the site. There was also conflicting messaging about the plan submitted by the Watershed District. She outlined an alternate design with an outlot that would be more attractive with a U-shaped roadway through it and lots based on smaller houses.
Marie Jackson, Patty Farris’s daughter, raised concerns about traffic on 168th as she had children and the street was already dangerous with no apparent speed limit.
Natalie Martin of 1657 South Manor Road stated there were along 168th no stop
signs, and she was concerned about traffic control with children and pets. The traffic study did not address the 17 additional houses with two drivers each and she asked how only 15 additional trips were the result. She requested there be traffic control at Mere Drive or some other alternative.
Paul Bloom of Manor Road echoed the traffic concerns with pets and children. Kate Olson of Manor Road raised issues related to the water management issue. She stated the developer in her area did not respect the water plan in the past and
she has had water issues in their yard for years. She asked how the City would
enforce this. Also she did not understand the zoning change, as the houses in the development seemed closer together than the zoning around it. MOTION: Grote moved, seconded by Taylor to close the public hearing. Motion
carried 8-0.
Sherwood asked for the speed limit for Eden Prairie on unmarked streets. Schulte replied it was 30 miles/hour. There was always a speed limit in Eden Prairie, whether posted or not.
Taylor asked what plans were there in place the ensure the outlot was suitable and would not cause the issues brought up. Schulte replied neighborhood did not have a lot of storm sewers to begin with so water flowed into low yards, particularly across 168th . There would be a separate area dry space where water would be
infiltrated per Watershed District requirements, running eventually into a pipe and
into the rest of the system. This would be an improvement from both the stormwater treatment and flooding perspective. It was meant to be a pond like other ponds in Eden Prairie, and the City would maintain the site. It had not been
PLANNING COMMISSION MINUTES April 8, 2024
Page 4
maintained because heretofore it had not been owned by the City. The water
would be captured and treated, improving the situation.
Pieper asked staff to address the traffic issues. Schulte replied this was not a highly recorded area for speed problems. At any rate, stop signs were not put in for speed control but to create right-of-way, and putting them in when not-
warranted was less safe on a long road. People would speed, and this could be
addressed by electric speed signs, more intersections condensed neighborhoods, parking on streets which naturally slowed traffic. More obstacles made streets safer and it was not common to have stop signs at every corner.
Farr stated he approved of the development which had many positive points.
Street connections offered more dispersion options rather than a funneling of traffic. It would conserve many trees. Eden Prairie had an aggressive tree conservation policy though the formula could be daunting. The City did a good job at allocating land for heritage trees in infill sites like this. The residents had a
fair expectation of the rules and regulation regarding construction hours of
operation and there would be phone numbers for residents to call. He added the applicant would have someone onsite every day. Farr added he supported the waivers.
Kirk stated with 15 years’ experience he had learned how developments evolved.
Eden Prairie had an established in-depth process for evaluating developers and all of this was looked at carefully. There were reasons for it. He wished to reemphasize what City Engineer Schulte said regarding the development which would improve traffic and water management and which provided sincere and
well-researched answers to staff. He found this to be a pretty well thought out
project, despite the challenges an infill project posed. He supported the development. Pieper echoed these sentiments and found the waivers to be minimal.
Farr added the outlot natural area was an amenity and planting nine or ten trees between Farris’s house and the pond would help. He urged Patty Farris to work with the developer on their placement.
Kirk asked staff to address the zoning. Barnhart replied R1 meant residential single family and 9.5 meant 9,500 square foot lot. The neighborhood to the east was zoned R1-9.5 and the neighborhood to the north and south were zoned R1-13.5 (13,500 square foot lots), and to the west R1-22 (22,000 square foot lots).
Duncan stated the residents’ comments were well-received and reiterated she heard major themes: traffic calming, water flow, zoning, and tree conservation. She did find the lots in the development appeared to be smaller than in the
PLANNING COMMISSION MINUTES April 8, 2024
Page 5
surrounding area. Sivilay added that higher priced homes would raise present
home values.
Taylor asked for and received confirmation the noise during construction would be limited to set weekday times and no pile driving would be taking place. Farr noted backup beeping was required by OSHA.
MOTION: Farr moved, seconded by Kirk to recommend PUD Concept Review of 6.43 acres, PUD District Review with waivers on 6.43 acres, Zoning Change from Rural to R1-9.5 on 6.43 acres, Preliminary Plat to divide one parcel into 17 lots and one outlot of 6.43 acres as represented in the April 8, 2024 staff report.
Motion carried 8-0.
B. LOTUS VILLAS ON ANDERSON LAKES (2024-02) Request for
• Guide Plan Change from Office to Low Density Residential on 5.0 acres
• PUD Concept Plan Review on 5.0 acres
• PUD District Review with waivers on 5.0 acres
• Zoning District Change from Office to R1-9.5 on 5.0 acres
• Preliminary Plan review on 5.0 acres
Mike Waldo with Ron Clark Construction displayed a PowerPoint and detailed
the application. He explained the hours of operation and that he had met with neighbors regarding noise and dust during construction. He displayed an area map with surrounding land use and explained it was previously zoned commercial.
Tim Witten, Witten Associates displayed the site plan showing the existing townhomes to the north and single-family residents to the south. He explained this was a transition project of detached single family homes. They had originally considered a mix of single and twin homes but after meeting with neighbors
decided on the villas. There would be 16 walkouts with full basements and three
in center slab on grade. He displayed the elevations and explained the benefits of a single developer/builder. Waldo explained the HOA would maintain driveways and do the mowing. There
would be a buffer easement instead of a drainage utility easement. The grading
plan would tie into berms from existing neighborhoods. Duncan asked for the demolition process. Waldo replied they would empty the building which would take two weeks or 12 working days. The materials would
be recycled and dust would be minimized with water.
PLANNING COMMISSION MINUTES April 8, 2024
Page 6
Barnhart presented the planning report. This was several requests to change the
land use from office to low density residential, a zoning change with waivers, a
PUD concept and district review with waivers, and Zoning Change and Preliminary Plat review, all on 5 acres. The project converted an existing office building into a 19-lot single family development. The villas were like a ‘detached’ townhome, with individual ownership of the unit, and HOA-maintained common
grounds, streets, and driveways.
Farr asked for and received confirmation the private drive at the north end terminated without a cul-de-sac and there were no concerns about firetruck access
Terry Pearson of 10827 Leaping Deer Lane stated her community (Weston
Woods) was very delighted about this project. She and President of the Board Joe Vorheck found the developer accessible and communicative. She asked Waldo to address the dirt, dust, and noise pollution and asked if the fence could be erected prior to construction.
Ted Mellbey of 11881 Germaine Terrace distributed his photograph and referenced the loss of trees in this development. He urged the commission members suggest the arborist Miss Commers examine the site and calculate the environmental harm. He asked how many significant trees would be removed
from this site and noted the replacements would not come close to replacing the
diameter of trees lost. He also asked if there was a difference between a variance and a waiver. MOTION: Grote moved, seconded by Sherwood to close the public hearing.
Motion carried 8-0.
Pieper asked staff to address the tree replacement. Barnhart replied the plan could be shared with Mellbey and put on the City’s website. Staff did consider City Code and did consult with the Parks Department and the arborist in replacing
these trees with smaller but better quality ones.
Sivilay asked for and received confirmation this development would not disrupt the neighboring communities. Waldo also explained there were no short-term rentals allowed. Also the arborist had been contacted directly and there would be
an excess of trees in the final result. He would also meet with the residents regarding the timing of the fencing. Taylor suggested a temporary fencing. Waldo agreed a silt fence was a possibility, but he did not want to order fencing before receiving an approval of his application by the City Council.
Farr noted on the east side there were lots with decreasing frontage and asked if these could be standardized. Waldo replied emergency overflow of water prevented this in that section. Pieper asked for and received confirmation the City would repair any street damage. Farr commended the development.
PLANNING COMMISSION MINUTES April 8, 2024
Page 7
MOTION: Kirk moved, seconded by Duncan to recommend approval for the
Guide Plan Change from Office to Low Density Residential on 5.0 acres, PUD Concept Plan Review on 5.0 acres, PUD District Review with waivers on 5.0 acres, Zoning District Change from Office to R1-9.5 on 5.0 acres, and Preliminary Plat review on 5.0 acres as represented in the April 8, 2024 staff report. Motion
carried 8-0.
C. ASIA MALL PARKING LOT EXPANSION (2024-01) Request for
• Planned Unit Development Concept Review on 4.69 acres
• Planned Unit District Amendment with waivers on 4.69 acres
• Site Plan Review on 4.69 acres
Lance Eliot of Eliot Design displayed a PowerPoint and detailed the application. This mall was on the site of Gander Mountain. Parking stalls had been full and patrons had been forced to park across Technology Drive and cross that road to visit the site. Construction would start in summer by Amcon if approved. There
were waivers to setback, impervious surface area, parking, and islands requested.
The application included landscaping and tree replacement and stormwater improvements. He displayed the existing conditions and explained the area where the parking lot would be expanded. At present there was a 155-stall deficit. He displayed and explained the parking calculations. 445 were required, and 425
were being requested. There were 290 stalls currently. He displayed the tree
replacement plan and the parking islands and explained the stormwater treatment plan. Sivilay agreed traffic was heavy especially on Sundays. He asked what vacancy
was in the building and what industries were represented in the vacancies. Eliot
replied to his understanding the building was at full capacity, which was what the traffic study was based on. There was a potential mezzanine that had not yet been constructed. Sivilay asked for and received confirmation this was the final parking plan.
Taylor asked if the developer could exceed safety capacity for the building. Eliot replied the traffic study was based on a safe standard but more visitors to the building were beyond his control.
Duncan asked for and received confirmation the new exit was exit only and there
would be lighting throughout the parking lot. There would be a sidewalk along the length of the parking lot. Farr praised the popularity of this amenity. He found no visible signage directing
drivers to the lower level parking. He disputed the applicant’s traffic counts,
PLANNING COMMISSION MINUTES April 8, 2024
Page 8
which did not actually count cars from current usage. He stated there were four or
five vacant storefronts when he visited the day before. Peak traffic movements
would give more accurate results than the manual. He asked how square footage and restaurant seated contributed to the parking problem which already existed. Eliot replied he was not involved in the restaurant approval but the original proposal was based on the estimates at that time, and the difference was not
significant. Farr stated the original application included a parking ramp. Eliot
replied there were challenges to building a parking ramp such as overhead power lines and the expansion would not have adverse impacts. The stormwater pond would be difficult with a ramp. Farr suggested alternative stall striping to yield one-way instead of two-way aisles with 60-degree parking. Eliot replied this had
been the first concept. The proposal was the best solution after several iterations.
Farr suggested pervious pavement alternatives, and Eliot agreed these were originally part of his proposal but he was dissuaded by City staff who found the underground storage system a superior choice. Farr asked for a condition to restore the site to previous conditions should the parking need wane in the future.
Eliot agreed to this condition upon talking with his clients.
Kirk asked for and received confirmation employees parked elsewhere and were brought in by bus. Eliot added that need would go away with the expansion but that service would still be provided if needed. Eliot conceded the parking
problems were ongoing. He added the parking study did not include an actual
parking count but the peaks in the study closely matched the numbers onsite, which actually yielded a deficit of 60 parking stalls. The proposal would yield 90 extra parking stalls, making a traffic count irrelevant. Kirk replied actual data was always preferable to estimated.
Pieper asked how many stalls were in the expansion, and Eliot replied there would be 80. He suggested no constructing the right expansion, and Eliot replied it did not meet City Code. The point was to maximize the number of parking stalls with the least amount of impact. Farr noted this was essentially a replacement proof-of-
parking plan asking for a higher total and stated he still distrusted the numbers.
Pieper commented on the signage that did not materialize. Kirk noted this was a unique problem the commission members did not anticipate. He stated the parking needed to be put in now, and the original estimates exacerbated the problem. He agreed the message seemed to be to build for the future need, not a present need
that would become inadequate. Pieper asked if there would be designated employee parking spots and Eliot replied there would not be, nor compact parking, but he was open to discussing it. Sivilay commended the attempt to address the problem, but doubted this was a
final plan. He asked if the original ramp had been looked into. Eliot replied cost was not always relevant but the cost for a ramp was prohibitive for the number of stalls it would yield, though he had not personally looked into it. He found the parking expansion as a whole was the permanent solution. He agreed with
PLANNING COMMISSION MINUTES April 8, 2024
Page 9
additional signage to direct people to the lower level. Sivilay asked why the
original plans were not followed. Eliot stated he could not answer this. Sivilay
asked how the present plans could be followed if the original ones weren’t. Eliot replied he was working with City staff to ensure this. Barnhart added staff could look into all conditions not followed.
Pieper asked for and received clarification this was a “permanent solution” to
meet the City cold rather than to actually meet peak demand. Eliot added the final number of parking stalls would substantively exceed the need so both were met. Taylor asked if there was a calculation for disabled spaces, and Barnhart replied he did not have a number but it would be ADA-conforming.
Barnhart presented the staff report. He explained this was a unique site as there were not many food court malls in Eden Prairie with no real opportunity for offsite parking. Staff tried to maximize the parking on the site which triggered waivers. This proposal reflected a balance of the Zoning Code with the big
picture. It did not meet a strict reading of the Code but met the expected parking
demand and decreased the ratio parking from the original waiver. Staff recommended approval based on conditions outlined in the staff report. Farr noted the “ghosted in” truck circulation plan did not provide an exit for
delivery or fire trucks. Barnhart replied trucks exited the main entrance. Farr
added there were no landscape areas for snow storage with the additional parking stalls up against lot lines. Barnhart replied the original agreement included trucking out the snow. Farr commented on the difference between retail and office parking. He warned against the customer becoming frustrated with this parking
plan.
MOTION: Grote moved, seconded by Taylor to close the public hearing. Motion carried 8-0.
Kirk stated the mall was a great addition to Eden Prairie and he wanted to see it
work, but see it work within safe and reasonable standards. The commission had been behind the proof-of-parking plan from the beginning, which was apparently unrealistic. This had driven many waivers, which he was not enthusiastic about but found reasonable. He was frustrated about not using actual data, and he did
not want to see the Planning Commission in this position again in the future. He wished this business to thrive and to adequately deal with the stormwater. Despite his reservations he supported this proposal. Farr stated he agreed with Kirk including the reservations, and found he could not
support this proposal. The total impact of the waivers could not make up for the inability to provided adequate parking, which could require a reduction in demand. While he did not want that, it was the unspoken issue needing to be addressed.
PLANNING COMMISSION MINUTES April 8, 2024
Page 10
Pieper stated this business was a tremendous asset but he felt this proposal was
overbuilt while not using actual data. In this unique situation he was not sure the commission should allow a build-to-Code and he liked Farr’s suggestion of a return to the original parking if demand decreased. He felt trepidation about this proposal and could not support it.
Grote asked if it was a reality that there was no more “build out” in Eden Prairie, only “build up.” Duncan asked for and received clarification the impervious pavement was
between 87 and 97 percent. The maximum permissible was 30 percent. Barnhart
would solidify the percentage before the application reached the City Council. Duncan expressed concern that a delay in approval would cause the problem to persist. Farr replied the mall would have to address its parking problems, such as closing certain shops or altering the hours of operation. Taylor asked for and
received clarification the City Council would vote on this, whether or not the
Planning Commission approved it. Kirk urged the commission members go on record for the City Council. Pieper asked for and received confirmation Barnhard was comfortable with the
peak use estimates.
MOTION: Kirk moved, seconded by Grote to recommend approval for Planned Unit Development Concept Review on 4.69 acres, Planned Unit District Amendment with waivers on 4.69 acres, and Site Plan Review on 4.69 acres as
represented in the April 8, 2024 staff report. Motion carried 5-3 (with Sivilay, Pieper, and Farr voting nay). PLANNERS’ REPORT
Barnhart stated he did not anticipate another meeting in April, and staff was
working on a number of Ordinance Amendments the commission would see in 60-90 days. MEMBERS’ REPORTS
VI. ADJOURNMENT MOTION: Taylor moved, seconded by Kirk to adjourn. Motion carried 8-0. The meeting was adjourned at 9:38 p.m.
From:ANDI SVENDSEN
To:Benjamin Schneider
Subject:Enclave at Manor Rd project
Date:Tuesday, March 26, 2024 9:47:57 AM
Hello Ben,
I've reviewed the plans online for this development. While I appreciate that Brandl
Anderson would like to leave as many trees as possible, I'm against granting a
variance reducing lot size to 65 feet and setback to 25 feet.
I do not feel that having the ability to add another lot so the development is more
profitable outweighs the impacts of granting their request. The environmental
statement regarding the Rusty Patched Bumble Bees does not take into account theother wildlife such as owls that live in those woods. I did not see the full
environmental impact report online with the other available documents to fully
understand the statement given the summary seems to be a cursory glance at the
vegetation. I also feel that reducing lot size to make high density housing is notappropriate for the location of this development given the surrounding houses and lot
sizes.
Please deny Brandl Anderson's request for lot size variances.
Sincerely, Andi Svendsen
16546 S Manor Rd
Eden Prairie, MN 55346
From:DONALD T HILL
To:Benjamin Schneider
Subject:Enclave at Manor Rd - Question
Date:Friday, March 29, 2024 12:16:59 PM
With the development moving the the water basin to the northwest corner along west
168th Ave. no homes will be next to the area.
Will Eden Prairie being taking care of the maintenance of snow removal on the
sidewalk in the winter and the cutting of the grass in the summer?
This winter even with the lack of snow we still had to walk in the street as nobody took
care of the snow removal.
ThanksDon Hill
16729 Honeysuckle Ln
Eden Prairie, MN 55346
From:Tim and Kay Peters
To:Benjamin Schneider;
Subject:Brandl Anderson Community Meeting from March 27
Date:Saturday, March 30, 2024 9:07:28 AM
Hello Ben,
I see you are the Project Planner for this new development (Enclave at Manor Rd). Please
forward this email to the correct manager/department that can best reply.
As a property owner with a City sidewalk, I'm responsible to clear a path on snowfalls greaterthan 2". There is both a City sidewalk and wheelchair ramp that runs on the west side of this
development. The neighborhood received @6" of snow around Feb 14th, and then greater than2" this past week. Neither time were the City sidewalk or access ramp cleared. This sidewalk
is well traveled by the neighbors. Is the City able to provide some direction to the newproperty owners on this City requirement?
With 17 new homes come the potential of 34 additional cars, plus any extra cars that will now
pass through when South Manor Road opens. High Trails Estate Park on West 168th Ave isadjacent to this development. What ideas is the City considering to ensure our children and
grandchildren can cross the street safely to enjoy this space?
Thanks,Tim Peters
6601 W 168th Ave
Requested Action Move to:
• Close the public hearing; and,
• Adopt a Resolution for a Guide Plan Change from Office to Low Density Residential on 5.0 acres; and
• Adopt a Resolution for a PUD Concept Plan Review on 5.0 acres; and
• Approve the 1st Reading of an Ordinance for a PUD District Review with waivers and a Zoning District Change from Office to R1-9.5 on 5.0 acres; and
• Adopt Resolution In Support of Park Dedication Fees on 5.0 acres; and
• Direct Staff to prepare a Development Agreement incorporating Staff and Commission recommendations and Council conditions; and
• Authorize the issuance of an early Land Alteration Permit for Lotus Villas on Anderson Lake
at the request of the Developer subject to the conditions outlined in the permit. Synopsis The applicant proposes removing the existing office building and redeveloping the property into 19 single
family lots and two outlots. The applicant describes the
development as a villa style neighborhood, where property owners own and maintain their home, but an association maintains the grounds, including lawn areas, driveways, and the private street. Development improvements
include a single looped private drive, utility and storm
water management improvements, a pond, landscaping, and screen fencing. The applicant requests a Comprehensive Plan land use
change to residential, which allows a density of 0.1-5.0
units per acre and a zoning district change to R1-9.5. Waivers are requested, summarized in the following table.
CITY COUNCIL AGENDA
SECTION: Public Hearings
DATE
May 7, 2024
DEPARTMENT/DIVISION:
Community Development/Planning
Julie Klima/Jeremy Barnhart
ITEM DESCRIPTION
Lotus Villas on Anderson Lake
ITEM NO.
IX.B.
Requirement Proposed
Lot Area 9500 sq ft Range between 6,826-15,632, average 8,654 15 of the 19 lots require waivers
Lot Width 70 feet Range between 37-77 feet, average 58 feet
13 of the 19 lots require waivers
Lots on a Public street All but 2 lots on private drive
Front Yard setback 30 feet 20 feet for 18 of the 19 lots
Rear Yard setback 20 feet Three lots backing to pond are 5 feet, all others comply
Lot Coverage of
impervious surface
30%, 46.7%
is current level
44.70%
Density 3.5 3.8
Summary Each of the lots will include a two car garage, and driveway parking for at least 2 vehicles. Parking on the
private street will be permitted for visitors. In compliance with the Sustainable Building Policy, each
building will include EV ready charging, and designed to support solar panels. Landscaping along the north and south boundary lines will remain, preserving the existing screening characteristics. Much of the slope and existing vegetation along Prairie Lakes Drive will also remain.
The applicant has provided elevation and floor plans, providing a variety of housing styles and options. Planning Commission and Public comment At its April 8, 2024 meeting, the Planning Commission reviewed the project, with discussion regarding
the lot size, neighborhood disruption, and tree preservation.
The applicant has had early and ongoing neighborhood interaction starting with the development of the plan. In response, the developer is adding a screening fence along the north boundary, and much of the existing vegetation along the south boundary line will be retained.
Public comment has been received, with most concerns focused on the noise and disruption associated with demolition and construction. The Planning Commission voted 8 to 0 to recommend approval of the project.
Attachments Attach 1 - Resolution for Guide Plan Change Attach 2 - Resolution for PUD Concept Review Attach 3 - Ordinance for Zoning District Change and PUD District Review with Waivers
Attach 4 – Resolution for Preliminary Plat
Attach 5 - Resolution for the Findings of Fact in Support of Park Dedication Attach 6 - Planning Commission Staff Report Attach 7 - Unapproved Minutes from April 8, 2024 Planning Commission Attach 8 – Applicant Narrative and Public Comments
CITY OF EDEN PRAIRIE
HENNEPIN COUNTY, MINNESOTA RESOLUTION NO. 2024-___ A RESOLUTION AMENDING THE
COMPREHENSIVE MUNICIPAL PLAN
WHEREAS, the City of Eden Prairie has prepared and adopted the Comprehensive Municipal Plan (“Plan”); and
WHEREAS, the Plan has been approved by the Metropolitan Council and was placed into effect on October 1, 2019; and WHEREAS, the proposal of Lotus Villas on Anderson Lake is for a
Comprehensive Guide Plan Change from Office to Low Density Residential on 5.0 acres,
as legally described on Exhibit A. NOW, THEREFORE, BE IT RESOLVED that the City Council of the City of Eden Prairie, Minnesota, hereby adopts the amendment of the Plan based on plans
stamped dated February 16, 2024 and the staff report dated April 8, 2024 and subject to
Metropolitan Council approval. ADOPTED by the City Council of the City of Eden Prairie this 7th day of May, 2024.
___________________________
Ronald A. Case, Mayor
ATTEST:
___________________________ David Teigland, City Clerk
EXHIBIT A
COMPREHENSIVE PLAN AMENDMENT
Legal Description:
The Land is described as follows: Tract B, Registered Land Survey No. 1550, Hennepin County, Minnesota. Torrens Property Torrens Certificate No. 1104669
CITY OF EDEN PRAIRIE HENNEPIN COUNTY, MINNESOTA
RESOLUTION NO. 2024-___ A RESOLUTION APPROVING THE PLANNED UNIT DEVELOPMENT CONCEPT OF LOTUS VILLAS ON ANDERSON LAKE
WHEREAS, the City of Eden Prairie has by virtue of City Code provided for the Planned Unit Development (PUD) Concept of certain areas located within the City; and
WHEREAS, the Planning Commission did conduct a public hearing on April 8, 2024, on
Lotus Villas on Anderson Lake and considered the request for approval of the PUD Concept Plan and recommended approval of the request to the City Council; and WHEREAS, the City Council did consider the request on May 7, 2024.
NOW, THEREFORE, BE IT RESOLVED by the City Council of Eden Prairie, Minnesota, as follows: 1. Lotus Villas on Anderson Lake, being in Hennepin County, Minnesota, legally
described as outlined in Exhibit A, is attached hereto and made a part hereof
(“Property”). 2. That the City Council does grant PUD Concept approval as outlined in the plans stamp dated February 16, 2024.
3. That the PUD Concept meets the recommendations of the Planning Commission dated April 8, 2024. ADOPTED by the City Council of the City of Eden Prairie this 7th day of May, 2024.
____________________________
Ronald A. Case, Mayor ATTEST: ____________________________
David Teigland, City Clerk
EXHIBIT A
PUD Concept
Legal Description:
The Land is described as follows:
Tract B, Registered Land Survey No. 1550, Hennepin County, Minnesota. Torrens Property Torrens Certificate No. 1104669
LOTUS VILLAS ON ANDERSON LAKE
CITY OF EDEN PRAIRIE HENNEPIN COUNTY, MINNESOTA ORDINANCE NO. -2024-PUD-_-2024
AN ORDINANCE OF THE CITY OF EDEN PRAIRIE, MINNESOTA, REMOVING CERTAIN LAND FROM ONE ZONING DISTRICT AND PLACING IT IN ANOTHER, AMENDING THE LEGAL DESCRIPTIONS OF LAND IN EACH DISTRICT, AMENDING THE DESIGNATION OF CERTAIN LAND WITHIN A ZONING DISTRICT, AND ADOPTING BY REFERENCE CITY CODE CHAPTER 1 AND
SECTION 11.99 WHICH, AMONG OTHER THINGS, CONTAIN PENALTY PROVISIONS THE CITY COUNCIL OF THE CITY OF EDEN PRAIRIE, MINNESOTA, ORDAINS:
Section 1. That the land which is the subject of this Ordinance (hereinafter, the
“land”) is legally described in Exhibit A attached hereto and made a part hereof. Section 2. That action was duly initiated proposing that the land be removed from the Office Zoning District and be placed in the R1-9.5 Zoning District.
Section 3. That action was duly initiated proposing that the designation of the land be amended within the R1-9.5 as -2024-PUD-_-2024 (hereinafter "PUD-_-2024”).
Section 4. The City Council hereby makes the following findings:
A. PUD-_-2024 is not in conflict with the goals of the Comprehensive Guide Plan of the City.
B. PUD-_-2024 is designed in such a manner to form a desirable and unified
environment within its own boundaries. C. The exceptions to the standard requirements of Chapters 11 and 12 of the City Code that are contained in PUD-_-2024 are justified by the design of the
development described therein.
D. PUD-_-2024 is of sufficient size, composition, and arrangement that its
construction, marketing, and operation are feasible as a complete unit without
dependence upon any subsequent unit. Section 5. The proposal is hereby adopted and the land shall be, and hereby is removed from the Office Zoning District and placed in the R1-9.5 Zoning District respectively as
noted in Exhibit A and shall be included hereafter in the Planned Unit Development PUD-_-2024
and the legal descriptions of land in each district referred to in City Code Section 11.03, shall be and are amended accordingly.
Section 6. The land shall be subject to the terms and conditions of that certain Development Agreement dated as of entered into between 10700 PLD Land LLC., and the City of Eden Prairie, (hereinafter “Development Agreement”). The Development Agreement contains the terms and conditions of PUD-_-2024, and are hereby made a part hereof.
Section 7. City Code Chapter 1 entitled “General Provisions and Definitions Applicable to the Entire City Code Including Penalty for Violation” and Section 11.99 entitled “Violation a Misdemeanor” are hereby adopted in their entirety by reference, as though repeated verbatim herein.
Section 8. The City Council determines that publication of the title and a summary of this ordinance clearly informs the public of the intent and effect of the ordinance, and directs that only the title of the ordinance and a summary attached as Exhibit B hereto be published, with notice that a printed copy of the ordinance is available for inspection by any person during
regular business hours at the office of the city clerk.
Section 9. This Ordinance shall become effective from and after its passage and publication.
FIRST READ at a regular meeting of the City Council of the City of Eden Prairie on
the May 7, 2024, and finally read and adopted and ordered published in summary form as attached hereto at a regular meeting of the City Council of said City on the ____ day of ________, 2024.
ATTEST: ___________________________ ___________________________
David Teigland, City Clerk Ronald A. Case, Mayor
PUBLISHED in the Sun Sailor on__________________, 2024.
EXHIBIT A
Rezone from Office to R1-9.5
Legal Description: The Land is described as follows: Tract B, Registered Land Survey No. 1550, Hennepin County, Minnesota.
Torrens Property Torrens Certificate No. 1104669
CITY OF EDEN PRAIRIE HENNEPIN COUNTY, MINNESOTA
RESOLUTION NO. 2024-___ RESOLUTION APPROVING THE PRELIMINARY PLAT OF LOTUS VILLAS ON ANDERSON LAKE
BE IT RESOLVED, by the Eden Prairie City Council as follows: That the preliminary plat of Lotus Villas on Anderson Lake dated February 16, 2024, and
consisting of 5.0 acres into 19 lots and 2 outlots, a copy of which is on file at the City Hall, is
found to be in conformance with the provisions of the Eden Prairie Zoning and Platting ordinances, and amendments thereto, and is herein approved subject to approval of the 2nd reading of the Ordinance for the Zoning District change and approval of the Development Agreement. ADOPTED by the Eden Prairie City Council on the 7th day of May, 2024. __________________________
Ronald A. Case, Mayor ATTEST:
__________________________ David Teigland, City Clerk
CITY OF EDEN PRAIRIE HENNEPIN COUNTY, MINNESOTA
RESOLUTION NO. 2024-____ A RESOLUTION ADOPTING FINDINGS OF FACT IN SUPPORT OF PARK DEDICATION FEES FOR LOTUS VILLAS ON ANDERSON LAKE WHEREAS, City Code Chapter 12, Section 12.40 Subd. 1 requires an owner of land being subdivided to dedicate to the public for public use as parks, playgrounds or public open space a reasonable portion of the land up to 10% thereof; and,
WHEREAS, in lieu of dedicating land, City Code Chapter 12, Section 12.40 Subd. 2; gives the City the option to require the developer to contribute an equivalent amount in cash in lieu of all or a portion of the land which the City may require such owner to dedicate in accordance with the schedule to be set by resolution of the Council;
WHEREAS, the Lotus Villas On Anderson Lake project includes subdivision of property pursuant to City Code Chapter 12 into 19 single-family lots and 2 outlots (the “Project”); WHEREAS the payment of cash park fees in lieu of land dedication is appropriate given the nature of the use on the property;
WHEREAS, the City’s current fee ordinance sets the cash park fee at $6,500 per residential unit, which amount was calculated in accordance with Minn. Stat. § 462.358, subd. 2b(c);
WHEREAS, the City Council held a public hearing at its May 7, 2024 meeting;
NOW, THEREFORE, BE IT HEREBY RESOLVED BY THE CITY COUNCIL OF THE CITY OF EDEN PRAIRIE, that the following findings are hereby adopted in support of
the imposition of a cash park fee in lieu of land dedication as a condition of subdivision approval for the Lotus Villas on Anderson Lake project:
1. The Project does not include available land that is suitable for parkland.
2. The Project includes the construction of 19 single-family homes. Development and
occupancy of the units is expected to have an impact on the City’s parks and trail system.
3. The Project is connected to a public sidewalk system providing access to a public trail along Prairie Lakes Drive and to parks and open spaces, increasing the likelihood that residents of the Project will use the City’s trails, parks, and open spaces.
4. The City has sidewalks and trails throughout the neighborhood. The City improves and
maintains the pedestrian and bicycle facilities for all residents to enjoy.
5. There is an essential nexus between requiring the cash park fees for the Project and the City’s goal of providing a high-quality park system for all individuals who live or work in
the City, including residents of the Project.
6. The need for parkland created by the Project is roughly proportional to the cash park fee amount required by the City’s fee ordinance. The cash park fees will be used for future anticipated park acquisition and improvement projects in the City, pedestrian and bicycle facility improvements, and other projects to improve City park and recreational facilities
that are likely to be used by residents of the Project.
ADOPTED by the City Council of the City of Eden Prairie this 7th day of May, 2024.
__________________________
Ronald A. Case, Mayor
ATTEST:
__________________________
David Teigland, City Clerk
TO: Planning Commission
FROM: Jeremy Barnhart, City Planner
DATE: April 8, 2024 SUBJECT: Lotus Villas on Anderson Lake (2024-02)
LOCATION: 10700 Prairie Lakes Drive REQUEST: • Guide Plan Change from Office to Low Density Residential on 5.0
acres
• PUD Concept Plan Review on 5.0 acres
• PUD District Review with waivers on 5.0 acres
• Zoning District Change from Office to R1-9.5 on 5.0 acres
• Preliminary Plat review on 5.0 acres
BACKGROUND
The existing 41,000 sq ft office building on site was built in 1982. The property owners propose to redevelop the property with a 19 lot single family residential development with a single, looped private road.
PRODUCT The developer proposes a project that they describe as a villa-style neighborhood. This
single family detached unit will be individually owned, but the yard areas, landscaping, streets, and other features of the project will be managed by a homeowner’s association.
Most of the homes will be a single story plus a basement. The three interior lots will feature 1 ½ story homes on a slab on grade foundation. Each unit will include 2 stall garages. Homes will be between 2,500 and 3,600 sq ft.
COMPREHENSIVE PLAN AMENDMENT The property is currently guided Office. The applicant is proposing to re-guide the property to
Low Density Residential (0.1-5.0 units per acre).
This designation allows only single family detached residential. The proposed density is 3.8
Staff Report – Lotus Villas on Anderson Lake
April 8, 2024 Page 2
2
units per acre. Parcels to the north and west are guided Medium Density Residential. Development to the south is Low Density Residential.
The change in land use is appropriate given the long term viability for the site as office and the surrounding land uses. Low Density Residential is preferred given the surrounding land uses and the lake to the east. ZONING DISTRICT CHANGE The property is currently zoned office. The applicant is proposing to change the zoning to R1-9.5. The proposed zoning change is consistent with the surrounding land uses, which include single family homes to the south, and twin homes to the north. SITE PLAN/ PRELIMINARY PLAT The nineteen lots are arranged around a single, looped private street. The private street intersects with Prairie Lakes Drive at two locations. There are no other vehicular connections, and no lot is afforded direct access onto Prairie Lakes Drive. A sidewalk is extended along Prairie Lakes Drive
and will connect to the existing trail near the SW corner of the site, on the west side of Prairie Lakes
Drive. With the goal of preserving the existing slope and vegetation along Prairie lakes Drive, a retaining wall is proposed along the west side of the project area, allowing the pond area to efficiently collect
stormwater throughout the site.
PARKING Each unit will have a two stall garage, and parking for two cars in the driveway. While not required for single family developments, up to 20 visitor vehicles can be parked along the curbs of the east/ west streets. The streets are 26 feet wide in these locations.
PLANNED UNIT DEVELOPMENT AND WAIVER REQUESTS The Planned Unit Development District is established for 4 main purposes: (1) Encourage a more creative and efficient approach to the use of land in the City;
(2) Allow variety in the types of environment available to the people of the City;
(3) Encourage more efficient allocation and maintenance of privately controlled common open space through the distribution of overall density of population and intensity of land use where such arrangement is desirable and feasible; and, (4) Provide the means for greater creativity and flexibility in environmental design than
is provided under the strict application of the provisions of this chapter while at the
same time preserving the health, safety, order, convenience, prosperity, and general welfare of the City and its inhabitants. The proposal addresses several of these goals with the provision of a single family home
Staff Report – Lotus Villas on Anderson Lake
April 8, 2024 Page 3
3
product with a controlled common open space, and variety in the types of environment in the
city. While there are waivers requested from the R1-9.5 zoning district, it is important to
consider that this district is the most closely suited for the product proposed. The City has not received a number of similar applications to warrant the development of an ordinance to accommodate the product, but will be monitoring the market for that option. The waivers requested include:
Lot area. The lots range in size from 6,826 sq ft to 15,632, with the average 8,654 sq ft.
the requirement of the R1-9.5 district is 9,500 sq ft. All lots but the 4 corner lots require the waiver. Lot width. The widths of each lot vary between 37 feet to 77 feet, with the average 58 feet. The code requires 70 feet of width. Corner lots are required to maintain a width of
at least 90 feet. All lots except for Lot 12, block 2 require the waiver.
Lots on a public street. All lots in a R1 zoning district require frontage on a public street. These lots are proposed on a private street. The intent with the requirement is to avoid flag lot situations, or lots with no access. Private streets are commonly used in managed developments like the proposed.
Front yard setbacks. The developer proposes a front yard setback of 20 feet (25 feet from
the back of curb) for all lots. The zoning code requires a 30 foot setback. Staff supports the reduced setback to bring the homes closer to the street, calming traffic, which preserving at least one car length for driveway parking without extending into the street. Rear yard setback. The three lots backing to the pond show a rear yard setback of
5 feet, less than the required 20 feet. This is in part due to the city’s preference that the
pond be within an outlot. In effect, the rear yards for these lots will appear larger, due to the open space and landscaping around the pond area. Lot coverage. The property is in the shoreland overlay district, where maximum lot coverage of impervious surfaces is 30%. The calculated lot coverage for the entire
project area is 44.7%, which is less that the current 46.7%. The lot coverage for each
individual lot is not known at this stage, but will be greater than 30%. Density. Density of the project is 3.8 units per acre. The maximum density for the R1-9.5 is 3.5 units per acre. The density of the neighborhood to the north is 4 units per acre, and 1.7 units per acre for the neighborhood to the south.
TREE LOSS AND GRADING As the site is currently developed, there are a number of trees that will be removed, including significant trees. There are no heritage trees on site. The size and the number of significant trees
removed requires 235.1 replacement caliper inches. The landscape plan shows 252 caliper inches
planted, exceeding the minimum. This calculation does not include landscaping provided at the foundation of the individual buildings.
Staff Report – Lotus Villas on Anderson Lake
April 8, 2024 Page 4
4
LANDSCAPING AND SCREENING
As a single family detached project, there is
no landscaping requirement. Of interest during the development process, however, was the preservation and enhancement of the existing vegetation along the north, west,
and south property lines to maintain the
existing screening in those areas. This is reflected on the landscaping plans. Additionally, as requested by the neighborhood to the north, the developer
proposes a 6 foot tall fence for additional
screening. SIDEWALKS AND TRAILS
A sidewalk along the east side of Prairie Lakes Drive will be extended to the south entrance to the
development, where a crossing will be added to connect to the existing trail on the west side of Prairie Lakes Drive. SIGNS
A monument sign is contemplated near the northern access to the site. Any monument sign will
need to conform to City Code. UTILITIES Water and sanitary sewer systems, up to the individual services will be public, maintained by the
city. Utility connections from the service, Storm water and the street will be private, maintained by
the owners or Homeowners association.
SUSTAINABILITY STANDARD
Since this is project is a Planned Unit Development, it triggers the City’s new sustainable building standard that has been in effect since January 1, 2024. For this project, all homes will have at least one EV-Ready parking space (garage charger) and roof trusses that meets Solar-Ready guidelines. Additionally the homes will be built under the MN Green Path program and utilize energy star
appliances.
NEIGHBORHOOD MEETING The applicant has communicated with the neighborhood association to the north, and the 4 abutting residents to the south as plans were developed. The applicant hosted a neighborhood
meeting on March 27th. A summary of that meeting is provided. One resident commented with
concern over the impending noise and dust related to the demolition of the site, and the
Staff Report – Lotus Villas on Anderson Lake
April 8, 2024 Page 5
5
construction of the project. City Code limits construction activities to between the hours of 7 am and 7 pm, exclusive of Sundays and legal holidays.
STAFF RECOMMENDATION Recommend approval of the following requests:
• Comprehensive Plan Amendment from Office to Low Density Residential in 5.0 acres
• PUD Concept Plan Review on 5.0 acres
• PUD District Review with waivers on 5.0 acres
• Zoning Change from Office to R1-9.5 on 5.0 acres
• Preliminary Plat to divide one parcel into 19 lots and 2 outlots on 5.0 acres This is based on plans submitted on March 14, 2024, staff report dated April 8, 2024, and the
following conditions:
1. Prior to release of the Final Plat, the applicant shall: A. Sign special assessment agreement for City trunk sewer and water assessment fees.
B. Submit a bond, letter of credit, or cash deposit (“security”) that guarantees completion
of all public utility improvements equivalent to 125% of the cost of the improvements.
2. Prior to land alteration permit issuance, the applicant shall:
A. Submit detailed stormwater runoff, wetland, utility, street, and erosion control plans for review and approval by the City Engineer. B. Obtain and provide documentation of Watershed District approval. C. Notify the City and Watershed District 48 hours in advance of grading.
D. Install erosion control at the grading limits of the property for review and approval by
the City. E. Submit a tree replacement letter of credit or escrow surety equivalent to 150% of the cost of the tree replacement. A surety will be required for each phase of tree replacement as shown on the Exhibit B Plans.
F. Submit a land alteration bond, letter of credit, or escrow surety equivalent to 125% of
the cost of the land alteration. G. Provide recorded copies of any Home Owner Association documents or private covenants and agreements. H. Submit construction plans and project specifications for public infrastructure for
review and approval by the city engineer.
3. Prior to building permit issuance for the property, the applicant shall: A. Pay the appropriate cash park fees.
UNAPPROVED MINUTES
EDEN PRAIRIE PLANNING COMMISSION
MONDAY, APRIL 8, 2024 7:00 PM—CITY CENTER Council Chambers 8080 Mitchell Road
COMMISSION MEMBERS: John Kirk, Frank Sherwood, Andrew Pieper, Ed Farr, Trisha Duncan, Robert Taylor, Dan Grote, Charles Weber; Phou Sivilay CITY STAFF: Jeremy Barnhart, City Planner; Carter Schulze, City Engineer; Matt Bourne, Manager of Parks and Natural Resources; Kristin Harley, Recording Secretary I. CALL THE MEETING TO ORDER Chair Pieper called the meeting to order at 7:00 p.m.
II. PLEDGE OF ALLEGIANCE – ROLL CALL
Chuck Weber was absent. Chair Pieper welcomed new commission member Trisha
Duncan. III. APPROVAL OF AGENDA
MOTION: Kirk moved, seconded by Taylor to approve the agenda. MOTION
CARRIED 8-0.
IV. MINUTES
MOTION: Sherwood moved, seconded by Kirk to approve the minutes of February 12,
2023 with the change from “used access agreement” to “shared access agreement” on
Item V, page 2, paragraph four. MOTION CARRIED 8-0.
V. PUBLIC HEARINGS
A. ENCLAVE AT MANOR ROAD (2023-14) Request for
• PUD Concept Review of 6.43 acres
• PUD District Review with waivers on 6.43 acres
• Zoning Change from Rural to R1-9.5 on 6.43 acres
PLANNING COMMISSION MINUTES April 8, 2024
Page 2
• Preliminary Plat to divide one parcel into 17 lots and one outlot on 6.43 acres Chris Contreras, President of Brandl Anderson Homes displayed a PowerPoint and detailed the application. He introduced his company and described the setback waiver to conserve more of the trees. The development would create 17
lots and one outlot. The landscape plan utilized a tree replacement formula replacing as many as possible, and also to fill in with plantings as many as possible. The timeframe anticipates completion in June 2024, with sales in August-September and the last home and escrow completed by April 2026. The houses would range from 2,400 to 4,000 square feet and be priced in the Low
700s. They would have stone accents, increased roof pitches, smart siding instead of vinyl and would be EV and solar ready. The developer could offer one-level homes but the target buyer was two-story homes. Barnhart presented the staff report. This was a subdivision with a right-of-way
and an outlot for stormwater management on the northwest corner of the site. The lots were orientated on the extension of South Manor Road. This was a redevelopment of an existing farm which was not historic, but would nevertheless be documented by the Heritage Preservation Commission. A waiver requested a front yard setback reduction from 30 to 25, and the front yard along 168th would
be reduced to 20 feet. Along the north side of the road the lot width would be reduced from 70 feet to 65 feet. Staff supported these waivers to manage and maintain existing vegetation. They allowed more space in backyards away from grading and vegetation. The project would try to design around existing vegetation and stormwater treatment, and it was a challenge because of the soils
and slope. The corner outlot was best case scenario of the available option. The developer had a tree replacement plan and screening plan. Staff recommended approval subject to the conditions in the staff report. Ted Mellby of 11881 Germaine Terrace questioned why no commission members
had any questions of the developer. He asked if they had visited the site and stated he would circulate a photograph of the tree removal at Pioneer Trail and Dell Road. He hoped the photograph would move the commissioners to leave as many trees as possible. He stated could not understand the tree replacement formula and would be meeting with City staff regarding his concerns.
Adam Driscoll of 6411 Mere Drive stated he respected the rights of the building and property owners but urged the commission members to consider noise and traffic during the construction phase. He asked for hours of operation and contacts to limit noise and disturbance. He stated there had been numerous near-misses in
the neighborhood and requested that construction related traffic use the west side of the development.
PLANNING COMMISSION MINUTES April 8, 2024
Page 3
Patty Farris stated she lived on 168th adjacent to the outlot and this development
would ruin the salability of her house along with the views she enjoyed. It would
create an island with just her house on the side. A pipe would be put through her yard tearing up her driveway and she had no assurances of repair. Many of the trees saved would be buckthorn and box elder junk trees. She pleaded for a pause on the development for this month so she could ask the developers for an
alternative plan with the outlot in the subdivision itself. She invited the
commission members to visit her and visit the site. There was also conflicting messaging about the plan submitted by the Watershed District. She outlined an alternate design with an outlot that would be more attractive with a U-shaped roadway through it and lots based on smaller houses.
Marie Jackson, Patty Farris’s daughter, raised concerns about traffic on 168th as she had children and the street was already dangerous with no apparent speed limit.
Natalie Martin of 1657 South Manor Road stated there were along 168th no stop
signs, and she was concerned about traffic control with children and pets. The traffic study did not address the 17 additional houses with two drivers each and she asked how only 15 additional trips were the result. She requested there be traffic control at Mere Drive or some other alternative.
Paul Bloom of Manor Road echoed the traffic concerns with pets and children. Kate Olson of Manor Road raised issues related to the water management issue. She stated the developer in her area did not respect the water plan in the past and
she has had water issues in their yard for years. She asked how the City would
enforce this. Also she did not understand the zoning change, as the houses in the development seemed closer together than the zoning around it. MOTION: Grote moved, seconded by Taylor to close the public hearing. Motion
carried 8-0.
Sherwood asked for the speed limit for Eden Prairie on unmarked streets. Schulze replied it was 30 miles/hour. There was always a speed limit in Eden Prairie, whether posted or not.
Taylor asked what plans were there in place the ensure the outlot was suitable and would not cause the issues brought up. Schulze replied neighborhood did not have a lot of storm sewers to begin with so water flowed into low yards, particularly across 168th . There would be a separate area dry space where water would be
infiltrated per Watershed District requirements, running eventually into a pipe and
into the rest of the system. This would be an improvement from both the stormwater treatment and flooding perspective. It was meant to be a pond like other ponds in Eden Prairie, and the City would maintain the site. It had not been
PLANNING COMMISSION MINUTES April 8, 2024
Page 4
maintained because heretofore it had not been owned by the City. The water
would be captured and treated, improving the situation.
Pieper asked staff to address the traffic issues. Schulze replied this was not a highly recorded area for speed problems. At any rate, stop signs were not put in for speed control but to create right-of-way, and putting them in when not-
warranted was less safe on a long road. People would speed, and this could be
addressed by electric speed signs, more intersections condensed neighborhoods, parking on streets which naturally slowed traffic. More obstacles made streets safer and it was not common to have stop signs at every corner.
Farr stated he approved of the development which had many positive points.
Street connections offered more dispersion options rather than a funneling of traffic. It would conserve many trees. Eden Prairie had an aggressive tree conservation policy though the formula could be daunting. The City did a good job at allocating land for heritage trees in infill sites like this. The residents had a
fair expectation of the rules and regulation regarding construction hours of
operation and there would be phone numbers for residents to call. He added the applicant would have someone onsite every day. Farr added he supported the waivers.
Kirk stated with 15 years’ experience he had learned how developments evolved.
Eden Prairie had an established in-depth process for evaluating developers and all of this was looked at carefully. There were reasons for it. He wished to reemphasize what City Engineer Schulze said regarding the development which would improve traffic and water management and which provided sincere and
well-researched answers to staff. He found this to be a pretty well thought out
project, despite the challenges an infill project posed. He supported the development. Pieper echoed these sentiments and found the waivers to be minimal.
Farr added the outlot natural area was an amenity and planting nine or ten trees between Farris’s house and the pond would help. He urged Patty Farris to work with the developer on their placement.
Kirk asked staff to address the zoning. Barnhart replied R1 meant residential single family and 9.5 meant 9,500 square foot lot. The neighborhood to the east was zoned R1-9.5 and the neighborhood to the north and south were zoned R1-13.5 (13,500 square foot lots), and to the west R1-22 (22,000 square foot lots).
Duncan stated the residents’ comments were well-received and reiterated she heard major themes: traffic calming, water flow, zoning, and tree conservation. She did find the lots in the development appeared to be smaller than in the
PLANNING COMMISSION MINUTES April 8, 2024
Page 5
surrounding area. Sivilay added that higher priced homes would raise present
home values.
Taylor asked for and received confirmation the noise during construction would be limited to set weekday times and no pile driving would be taking place. Farr noted backup beeping was required by OSHA.
MOTION: Farr moved, seconded by Kirk to recommend PUD Concept Review of 6.43 acres, PUD District Review with waivers on 6.43 acres, Zoning Change from Rural to R1-9.5 on 6.43 acres, Preliminary Plat to divide one parcel into 17 lots and one outlot of 6.43 acres as represented in the April 8, 2024 staff report.
Motion carried 8-0.
B. LOTUS VILLAS ON ANDERSON LAKES (2024-02) Request for
• Guide Plan Change from Office to Low Density Residential on 5.0 acres
• PUD Concept Plan Review on 5.0 acres
• PUD District Review with waivers on 5.0 acres
• Zoning District Change from Office to R1-9.5 on 5.0 acres
• Preliminary Plan review on 5.0 acres
Mike Waldo with Ron Clark Construction displayed a PowerPoint and detailed
the application. He explained the hours of operation and that he had met with neighbors regarding noise and dust during construction. He displayed an area map with surrounding land use and explained it was previously zoned commercial.
Tim Witten, Witten Associates displayed the site plan showing the existing townhomes to the north and single-family residents to the south. He explained this was a transition project of detached single family homes. They had originally considered a mix of single and twin homes but after meeting with neighbors
decided on the villas. There would be 16 walkouts with full basements and three
in center slab on grade. He displayed the elevations and explained the benefits of a single developer/builder. Waldo explained the HOA would maintain driveways and do the mowing. There
would be a buffer easement instead of a drainage utility easement. The grading
plan would tie into berms from existing neighborhoods. Duncan asked for the demolition process. Waldo replied they would empty the building which would take two weeks or 12 working days. The materials would
be recycled and dust would be minimized with water.
PLANNING COMMISSION MINUTES April 8, 2024
Page 6
Barnhart presented the planning report. This was several requests to change the
land use from office to low density residential, a zoning change with waivers, a
PUD concept and district review with waivers, and Zoning Change and Preliminary Plat review, all on 5 acres. The project converted an existing office building into a 19-lot single family development. The villas were like a ‘detached’ townhome, with individual ownership of the unit, and HOA-maintained common
grounds, streets, and driveways.
Farr asked for and received confirmation the private drive at the north end terminated without a cul-de-sac and there were no concerns about firetruck access
Terry Pearson of 10827 Leaping Deer Lane stated her community (Weston
Woods) was very delighted about this project. She and President of the Board Joe Vorheck found the developer accessible and communicative. She asked Waldo to address the dirt, dust, and noise pollution and asked if the fence could be erected prior to construction.
Ted Mellby of 11881 Germaine Terrace distributed his photograph and referenced the loss of trees in this development. He urged the commission members suggest the arborist Miss Commers examine the site and calculate the environmental harm. He asked how many significant trees would be removed from this site and
noted the replacements would not come close to replacing the diameter of trees
lost. He also asked if there was a difference between a variance and a waiver. MOTION: Grote moved, seconded by Sherwood to close the public hearing. Motion carried 8-0.
Pieper asked staff to address the tree replacement. Barnhart replied the plan could be shared with Mellby and put on the City’s website. Staff did consider City Code and did consult with the Parks Department and the arborist in replacing these trees with smaller but better quality ones.
Sivilay asked for and received confirmation this development would not disrupt the neighboring communities. Waldo also explained there were no short-term rentals allowed. Also the arborist had been contacted directly and there would be an excess of trees in the final result. He would also meet with the residents
regarding the timing of the fencing. Taylor suggested a temporary fencing. Waldo agreed a silt fence was a possibility, but he did not want to order fencing before receiving an approval of his application by the City Council. Farr noted on the east side there were lots with decreasing frontage and asked if
these could be standardized. Waldo replied emergency overflow of water prevented this in that section. Pieper asked for and received confirmation the City would repair any street damage. Farr commended the development.
PLANNING COMMISSION MINUTES April 8, 2024
Page 7
MOTION: Kirk moved, seconded by Duncan to recommend approval for the
Guide Plan Change from Office to Low Density Residential on 5.0 acres, PUD
Concept Plan Review on 5.0 acres, PUD District Review with waivers on 5.0 acres, Zoning District Change from Office to R1-9.5 on 5.0 acres, and Preliminary Plat review on 5.0 acres as represented in the April 8, 2024 staff report. Motion carried 8-0.
C. ASIA MALL PARKING LOT EXPANSION (2024-01) Request for
• Planned Unit Development Concept Review on 4.69 acres
• Planned Unit District Amendment with waivers on 4.69 acres
• Site Plan Review on 4.69 acres
Lance Eliot of Eliot Design displayed a PowerPoint and detailed the application.
This mall was on the site of Gander Mountain. Parking stalls had been full and patrons had been forced to park across Technology Drive and cross that road to visit the site. Construction would start in summer by Amcon if approved. There were waivers to setback, impervious surface area, parking, and islands requested.
The application included landscaping and tree replacement and stormwater
improvements. He displayed the existing conditions and explained the area where the parking lot would be expanded. At present there was a 155-stall deficit. He displayed and explained the parking calculations. 445 were required, and 425 were being requested. There were 290 stalls currently. He displayed the tree
replacement plan and the parking islands and explained the stormwater treatment
plan. Sivilay agreed traffic was heavy especially on Sundays. He asked what vacancy was in the building and what industries were represented in the vacancies. Eliot
replied to his understanding the building was at full capacity, which was what the
traffic study was based on. There was a potential mezzanine that had not yet been constructed. Sivilay asked for and received confirmation this was the final parking plan.
Taylor asked if the developer could exceed safety capacity for the building. Eliot
replied the traffic study was based on a safe standard but more visitors to the building were beyond his control. Duncan asked for and received confirmation the new exit was exit only and there
would be lighting throughout the parking lot. There would be a sidewalk along the
length of the parking lot. Farr praised the popularity of this amenity. He found no visible signage directing drivers to the lower level parking. He disputed the applicant’s traffic counts,
which did not actually count cars from current usage. He stated there were four or
PLANNING COMMISSION MINUTES April 8, 2024
Page 8
five vacant storefronts when he visited the day before. Peak traffic movements
would give more accurate results than the manual. He asked how square footage
and restaurant seated contributed to the parking problem which already existed. Eliot replied he was not involved in the restaurant approval but the original proposal was based on the estimates at that time, and the difference was not significant. Farr stated the original application included a parking ramp. Eliot
replied there were challenges to building a parking ramp such as overhead power
lines and the expansion would not have adverse impacts. The stormwater pond would be difficult with a ramp. Farr suggested alternative stall striping to yield one-way instead of two-way aisles with 60-degree parking. Eliot replied this had been the first concept. The proposal was the best solution after several iterations.
Farr suggested pervious pavement alternatives, and Eliot agreed these were
originally part of his proposal but he was dissuaded by City staff who found the underground storage system a superior choice. Farr asked for a condition to restore the site to previous conditions should the parking need wane in the future. Eliot agreed to this condition upon talking with his clients.
Kirk asked for and received confirmation employees parked elsewhere and were brought in by bus. Eliot added that need would go away with the expansion but that service would still be provided if needed. Eliot conceded the parking problems were ongoing. He added the parking study did not include an actual
parking count but the peaks in the study closely matched the numbers onsite,
which actually yielded a deficit of 60 parking stalls. The proposal would yield 90 extra parking stalls, making a traffic count irrelevant. Kirk replied actual data was always preferable to estimated.
Pieper asked how many stalls were in the expansion, and Eliot replied there would
be 80. He suggested no constructing the right expansion, and Eliot replied it did not meet City Code. The point was to maximize the number of parking stalls with the least amount of impact. Farr noted this was essentially a replacement proof-of-parking plan asking for a higher total and stated he still distrusted the numbers.
Pieper commented on the signage that did not materialize. Kirk noted this was a
unique problem the commission members did not anticipate. He stated the parking needed to be put in now, and the original estimates exacerbated the problem. He agreed the message seemed to be to build for the future need, not a present need that would become inadequate. Pieper asked if there would be designated
employee parking spots and Eliot replied there would not be, nor compact parking, but he was open to discussing it. Sivilay commended the attempt to address the problem, but doubted this was a final plan. He asked if the original ramp had been looked into. Eliot replied cost
was not always relevant but the cost for a ramp was prohibitive for the number of stalls it would yield, though he had not personally looked into it. He found the parking expansion as a whole was the permanent solution. He agreed with additional signage to direct people to the lower level. Sivilay asked why the
PLANNING COMMISSION MINUTES April 8, 2024
Page 9
original plans were not followed. Eliot stated he could not answer this. Sivilay
asked how the present plans could be followed if the original ones weren’t. Eliot
replied he was working with City staff to ensure this. Barnhart added staff could look into all conditions not followed. Pieper asked for and received clarification this was a “permanent solution” to
meet the City cold rather than to actually meet peak demand. Eliot added the final
number of parking stalls would substantively exceed the need so both were met. Taylor asked if there was a calculation for disabled spaces, and Barnhart replied he did not have a number but it would be ADA-conforming.
Barnhart presented the staff report. He explained this was a unique site as there
were not many food court malls in Eden Prairie with no real opportunity for offsite parking. Staff tried to maximize the parking on the site which triggered waivers. This proposal reflected a balance of the Zoning Code with the big picture. It did not meet a strict reading of the Code but met the expected parking
demand and decreased the ratio parking from the original waiver. Staff
recommended approval based on conditions outlined in the staff report. Farr noted the “ghosted in” truck circulation plan did not provide an exit for delivery or fire trucks. Barnhart replied trucks exited the main entrance. Farr
added there were no landscape areas for snow storage with the additional parking
stalls up against lot lines. Barnhart replied the original agreement included trucking out the snow. Farr commented on the difference between retail and office parking. He warned against the customer becoming frustrated with this parking plan.
MOTION: Grote moved, seconded by Taylor to close the public hearing. Motion carried 8-0. Kirk stated the mall was a great addition to Eden Prairie and he wanted to see it
work, but see it work within safe and reasonable standards. The commission had
been behind the proof-of-parking plan from the beginning, which was apparently unrealistic. This had driven many waivers, which he was not enthusiastic about but found reasonable. He was frustrated about not using actual data, and he did not want to see the Planning Commission in this position again in the future. He
wished this business to thrive and to adequately deal with the stormwater. Despite his reservations he supported this proposal. Farr stated he agreed with Kirk including the reservations, and found he could not support this proposal. The total impact of the waivers could not make up for the
inability to provided adequate parking, which could require a reduction in demand. While he did not want that, it was the unspoken issue needing to be addressed.
PLANNING COMMISSION MINUTES April 8, 2024
Page 10
Pieper stated this business was a tremendous asset but he felt this proposal was
overbuilt while not using actual data. In this unique situation he was not sure the
commission should allow a build-to-Code and he liked Farr’s suggestion of a return to the original parking if demand decreased. He felt trepidation about this proposal and could not support it.
Grote asked if it was a reality that there was no more “build out” in Eden Prairie,
only “build up.” Duncan asked for and received clarification the impervious pavement was between 87 and 97 percent. The maximum permissible was 30 percent. Barnhart
would solidify the percentage before the application reached the City Council.
Duncan expressed concern that a delay in approval would cause the problem to persist. Farr replied the mall would have to address its parking problems, such as closing certain shops or altering the hours of operation. Taylor asked for and received clarification the City Council would vote on this, whether or not the
Planning Commission approved it. Kirk urged the commission members go on
record for the City Council. Pieper asked for and received confirmation Barnhard was comfortable with the peak use estimates.
MOTION: Kirk moved, seconded by Grote to recommend approval for Planned Unit Development Concept Review on 4.69 acres, Planned Unit District Amendment with waivers on 4.69 acres, and Site Plan Review on 4.69 acres as represented in the April 8, 2024 staff report. Motion carried 5-3 (with Sivilay,
Pieper, and Farr voting nay).
PLANNERS’ REPORT Barnhart stated he did not anticipate another meeting in April, and staff was working on a number of Ordinance Amendments the commission would see in
60-90 days. MEMBERS’ REPORTS
VI. ADJOURNMENT MOTION: Taylor moved, seconded by Kirk to adjourn. Motion carried 8-0. The meeting was adjourned at 9:38 p.m.
7500 West 78th Street Edina, MN 55439
(952) 947-3000
MN Builder License # 1220 www.RonClark.com
Monday February 19, 2024 – Updated March 20, 2024 Jeremy Barnhart, AICP City of Eden Prairie
8080 Mitchel Road Eden Prairie, MN 55344 RE: Lotus Villas, on Anderson Lake
Ron Clark Construction is proposing a detached Villa Home neighborhood on the existing
5-acre property located at 10700 Prairie Lakes Drive, the site currently is a 40,000 square foot
Office Building/Data Center.
The proposed For-Sale single family detached Villa Home neighborhood would have nineteen
(19) Villa Homes. Each home will have at least a 2-car garage with a minimum of additional
parking for 2 cars in each driveway and approximately 20 guest parking stalls available on the
private street. The project will have private streets owned and maintained by the
Homeowners Association (HOA) with public sewer & water within an easement dedicated to
the city.
The overall goal is to work in balance with the existing natural elements of the site while
adding new housing to create a small neighborhood that aligns with the surrounding
residential areas. The current use of the site clearly does not fit in with the rest of the
surrounding residential areas. The maintenance free, main level living design is in high
demand for existing Eden Prairie residents that are looking for a ‘Lifestyle’ option while still
staying in Eden Prairie near their children and grandchildren. This also, through their existing
homes, grants access to young families aspiring to raise their children within the high-quality
Eden Prairie schools.
The Villas Homes around the exterior of the site will all be single story homes, however the 3
slab-on-grade Villa Homes near the pond will allow for a story and a half design being they
have no lower-level areas. Whether this site is developed with 15, 19 or 25 homes, the overall
lot coverage, street layout and utility design would be very similar. However, by opting for
Villa Homes, you benefit from a streamlined approach with a singular developer, a single
builder, and a unified homeowners association. This ensures that the project's completion and
maintenance align with the approved design.
7500 West 78th Street Edina, MN 55439
(952) 947-3000
MN Builder License # 1220 www.RonClark.com
Comprehensive Guide Plan Change: The current guiding for the site is Office and is
occupied by an approximately 40,000 square foot Office Building/Data Center. We are
requesting a change to Low Density Residential. The change in land use of this small parcel
will have a very minimal effect on the balance of land use within the city. The requested land
use of Low Density Residential is consistent with the surrounding neighborhoods on all sides
of the property. The land use change will result in no increase in city utility and road services
from the current commercial use, with traffic and most other needs being reduced by the new
detached single-family use. We feel very strongly that the single-family land use for the site is
a more appropriate use for the site than the current office building.
Zoning Change: The current zoning for the site is OFC Office and is occupied by an
approximately 40,000 square foot Office Building/Data Center. The proposed zoning would
change the property to R1-9.5 which allows for single family detached structures with the
waivers requested below for this empty nester detached Villa Home style neighborhood. The
density we are requesting is 3.8 units per acre, slightly above the allowed 3.5 units per acre,
which we feel is reasonable as the footprint and overall size of the Villa homes will be less
than what a standard single-family home would be. Also, the proposed street, utility layout,
impervious area and the buildable area of the Villa lots would not be any more than a less
dense traditional single-family design. Our proposal includes the use of the PUD flexibility
which allows us to create our most functional site plan and building layout for the empty
nester detached Villa Home neighborhood.
The project will also increase the tax value for the city significantly, the current assessed
value is $4,370,000 (with the real value about ½ that amount), this new Villa neighborhood
will have a projected value for the 19 homes of over 20 million once completed.
To create this Villa neighborhood, we have the below applications included:
1) Comprehensive Guide Plan Change from Office to Low Density Residential
2) Rezoning Application – OFC Office to R1-9.5 Single Family
3) Subdivision Waivers requested
a. Waiver for Coverage of over 30%, but we are less than prior use.
b. Density waiver because of Villa Home style allowing for 3.8 units/acres vs 3.5
units/acre
c. Lot size waiver because of Villa Home style for 6,770 sq ft vs.9,500
d. Lot width waiver because of Villa Home style for 55 feet wide vs. 70 feet wide
e. Side yard setbacks of 7.5 feet on each side of home for a total of 15 feet
between homes
7500 West 78th Street Edina, MN 55439
(952) 947-3000
MN Builder License # 1220 www.RonClark.com
f. Front yard setback of 25 feet minimum from private street to garage face vs 30
feet
g. Rear yard setback on the 3 homes that back up to the pond to be 5 feet vs 20
feet, they will still have open space and ponding behind them
4) Preliminary Plat Application
5) Request release of the prior Developers Agreement on the site with the use change
Preliminary Neighborhood discussions prior to submittal
We met with the HOA Board and a few other homeowners from the Weston Woods
townhome area to the north in early December as we started to plan out the area. Then a week
later we met with a few of the closest neighbors of the single-family area to the south of the
site. Both seem generally supportive of the change to residential zoning and the Villa style
product. A few of the townhome neighbors would like a fence along our shared property line
as their homes look directly across the street at our property. We have focused on both
preserving and enhancing the landscaping between us and the two neighborhoods. In general,
the neighbors were looking for additional information that is included in this submittal before
making a final decision on our new neighborhood, but we think even though change is always
hard, that they agreed the residential use is much better long-term use for the site.
Wetland and Shoreland Area along Anderson Lake
We have submitted to the Nine Mile Watershed District to confirm there are no wetlands on
the site or adjacent to the site that affect the project setbacks or restrictions. The Shoreland
map shows we are not within the Shoreland impact zone for any portion of the site. The
impervious coverage percentages are included on the Site Plan and show a reduction in
impervious from the prior use of about 5% (4,300 sq ft)
Concept plan comments from Staff
We provided an initial concept plan to staff in December to determine if we were on the right
path with the site redesign. We received comments from each department and feel we have
addressed most of those comments or explained the reasons why. One item discussed was
sidewalks within the neighborhood. We are not proposing any internal sidewalks with the
limited traffic of only 19 Villa Homes, this is consistent with the neighborhoods north and
south, that do not have internal sidewalks as well. We will be extending the current sidewalk
along Prairie Lakes Drive along the front of our property. Residents will also be able to walk
across Prairie Lakes Drive and connect to the Center Way trail and which gives access Nesbitt
Preserve Park.
7500 West 78th Street Edina, MN 55439
(952) 947-3000
MN Builder License # 1220 www.RonClark.com
Development Recap:
1) Setbacks
a. The project is requesting the following setback waivers from the standard for
the R1-9.5 Single family district.
b. 7.5-foot side yard setback resulting in a minimum of 15 feet between the Villa
homes.
c. We are providing a 30-foot setback from the adjoining neighborhoods to the
south and north vs the 20-foot standard.
d. On the 3 homes backing up to pond we are requesting a 5-foot rear yard
setback.
2) Stormwater impact
a. See included stormwater report and compliance with both City and Watershed
District requirements.
b. All runoff from the homes will be piped to the stormwater system and into the
pond, only the water landing on the grass in the rear of the homes will continue
to leave the site.
3) Buildable area of site
a. Total Site Area = 5.00 ac
b. Buildable Area of Site = 5.00 ac
c. Density on buildable area = 19 units/5.00 ac = 3.8 units/acre
d. We are requesting a Waiver or Density from 3.5 to 3.8 units/acre.
4) Lighting
a. The site will have street lighting similar to the 2 adjoining neighborhoods.
b. The homes will have soffit or wall sconce exterior lighting on the front of the
garage controlled by a photocell.
5) Parking for visitors
a. All driveways can accommodate two (2) or more cars, plus each Villa Home
has two (2) car garages and are required to not store anything in the garage that
would not allow for them to park 2 cars internally.
b. Additional parking is also available on the private street, this will
accommodate approximately 20 cars.
7500 West 78th Street Edina, MN 55439
(952) 947-3000
MN Builder License # 1220 www.RonClark.com
c. The private Street will be a city standard 26 foot back-to-back, which allows
for parking on one side. Driveways are a minimum of 20 feet wide at the
garage, easily allowing for 2 cars to park in each driveway.
d. The Minimum distance from the private street to the face of garage is 25 feet.
6) Tree Removal and Replacement Plan
a. A Tree Removal and Replacement Plan is provided with our proposal. Our
landscape architect has worked closely with the city staff to form an acceptable
plan that complies with and/or exceeds the minimums of the City Tree
Ordinance.
b. Even though most of the Ash trees we are removing are showing signs of
damage from the emerald ash bore, we are still replacing them as required by
the ordinance.
c. The Ash trees we are saving were treated in 2022 and the HOA will continue
to treat them going forward, if they are later forced to remove the Ash trees,
the HOA will replace them with new trees at that time.
7) Landscaping Plans and Screening
a. A fully designed landscaping plan is provided with our application.
b. We provided an additional 10 feet of rear yard setback to the adjoining
properties along with additional plantings and a 6-foot-high fence to the north
as requested by the neighbors. The area behind the homes even though owned
by the resident will have Buffer Easement placed on that area related to
maintaining required drainage but still allow buffer planting which will make
sure that both are maintained, any dead or damaged trees are replaced, and the
current drainage flow will be maintained properly per the final grading plan. If
at any point these areas are not maintained as required, the city will be allowed
to correct the issue and assess the HOA and/or Homeowner for it. With this
Buffer Easement in place it allows for more plantings to be included in this
area vs. a utility/drainage easement which would not allow for any tree
planting.
c. The 25-foot setback along Prairie Lakes Drive will also have additional shrubs
and trees to maintain and improve the current streetscape.
8) Lot sizes and building footprint coverage
7500 West 78th Street Edina, MN 55439
(952) 947-3000
MN Builder License # 1220 www.RonClark.com
a. See the attached Preliminary Plat showing the individual lot sizes, buildable
area for each lot and proposed building footprint size for each house.
b. We are requesting lot size waiver to 6,770 sq ft from 9,500 and a waiver for lot
width to 55 feet from 70 feet for the Villa Homes.
9) Traffic Memo
a. Included with the submittal is a traffic memo from a traffic engineer, showing
the before and after expected traffic counts. As expected, the residential use is
lower traffic than the prior use, in addition the Villa product being focused on
empty nesters has reduced traffic form traditional single family.
10) Green infrastructure Analysis
a. We have included a recap of the techniques and best management practices we
will use for the development of the site.
11) City’s Inclusionary Housing Policy
a. The project is single family detached and exempt from the City’s Inclusionary
Housing Policy.
12) Sustainable Building Standard/Features
a. All Homes will be built under the MN Green Path Program which is focused
on energy savings and sustainability. This will result in more than a 30%
increase in efficiency in the homes. We will achieve a 50 HERS rating or
below in all homes.
b. We will have an EV-Ready Garage in each home, install per city
specifications, each homeowner will then decide if they want/need a finished
charger system to adapt to the wide variety of charging systems currently on
the market. Termination location will be clearly marked.
c. We utilize many of the Energy Star appliances and Water Sense fixtures
available depending on customer selections.
d. Solar Ready the homes will have trusses designed to allow for the additional
weight of solar panels in the future along with a conduit from the roof to the
Electric panel. We will also provide in the HOA declaration that Solar panels
would be allowed on the roof. We will also make sure that the electrical panel
has open spaces in it to allow for the connection to solar power in the future
7500 West 78th Street Edina, MN 55439
(952) 947-3000
MN Builder License # 1220 www.RonClark.com
Housing and Architecture: The single-family detached Villa Homes will be planned and
designed to fit into the existing neighborhood but also will add a new style of housing not
currently in the neighborhood. We are planning a mix of home designs that range between
2,500 and 3,600 square feet. The home designs will offer two car-plus garages, sunrooms,
porches, and decks with a variety internal floorplans and exterior styles. The overall
Architecture is still in the development stage, we have provided visual examples and if you
look at our current and past projects you will get a sense of the quality of the homes and the
variety of the exterior designs. The 3 homes backing up to the pond will offer a slab-on-grade
design with the potential for a story and a half design element. Many lots will allow for either
a front load or courtyard (side load) garage, this will be decided as each home is built and is
not predetermined.
Homeowners Association (HOA): A Homeowners Association will be planned for the
neighborhood. The Association will maintain each home’s lawn care and snow removal along
with maintaining all common area landscaping and the monument. The Homeowners
Association will be responsible for continuing to actively maintain the rear yard drainage as
shown on the grading plan along with maintaining the buffer planting as approved in those
areas. With the Buffer Easement in place the Homeowners Association, coupled with the
city's monitoring rights, facilitates the inclusion of more trees in the buffer areas between
neighborhoods. This approach surpasses the tree planting that would be permissible if the area
were designated as a drainage easement.
Development Team:
Project Architect – Whitten Associates, Inc. – Tim Whitten and Heather Maanum Project Engineer – Campion Engineering - Marty Campion
Project Surveyor – Westwood – Chris Ambourn Developer and Builder – Ron Clark Construction – Mike Waldo and Landon Wittenberg
10700 Neighborhood Meeting Summary
3/27/2024
Noted Questions and Concerns from Neighbors:
Mike Waldo did an overall recap of the project, the proposed 19 villas, then change in land use to
low density Single Family from office/commercial and process for approval, etc. Discuss similar
projects we have done in other communities and a little about Ron Clark construction and the fact
we will be the developer and builder which allow for a much more seamless process, if any issues
arise they can always call or email him directly
• Fence & landscape buffer to adjacent properties.
o We have proposed a new 6 foot high fence on the northwest side as requested by a
few of the townhome neighbors, that fence and specification is included in our
submittal and was shown to meeting attendees. To the south we will work
individually with each neighbor to determine the best screening plan, they all have
existing fences and replacement of those fences may do more damage to the
existing planting then just leaving as is.
o Do we have flexibility to work with neighbors regarding tree plantings/landscaping
on both sides of property line? This is something to be discussed with city as we
move forward. We stated we will work with the south neighbors to do plantings, ect.
on our site and maybe a few trees/plants on their property if that provides the best
screening for both properties.
• Construction traffic/timeline
o What is projected timeline for demolition? And start date? Shooting for early June
Demo start and should complete the demo scope in 2 weeks.
o Discussed that building has had a site Phase 1 and Hazardous materials survey
completed and the couple minor items (window caulk, etc.) will be removed prior t
any demo work being started.
o How will possible dust/air pollution be mitigated? When speaking with Demo
vendors, if need be, they will use water to mitigate dust/air pollution.
o What is expected construction traffic? At most this will be 60 or so trucks a day
hauling at certain points throughout the initial demo and grading process.
o Who’s responsible for keeping prairie lakes dr. clean and free of debris? This will be
maintained by street sweeping at least twice a week if not more.
• Home values & property taxes
o How will this affect neighboring home values and property taxes? Overall, this
project will be priced higher than neighboring homes therefore economically
speaking this should increase home values. With that said, property taxes may
increase but not dramatically as this new project should bring in about 25-
30,000,000 of increased tax base.
o What is projected price point of these units? Most likely anywhere from just under a
$1 million to $1.5 million.
o How “custom are these homes” and will all be built from scratch for each
homeowner? We will deliver 3 or so specs/model immediately. Most buyers will go
ahead and customize their fixtures and finishes. For example, kitchen appliances,
flooring, tile, etc. Each villa will not be a full-blown custom home, but we are not the
run of the mill “cookie cutter” builder. Most units will have variances between them
regarding finishes, giving each villa its own unique finish.
Other Noted Questions:
• HOA Structure - Should be similar to Greenway Villas in Golden Valley.
• Why private street? - Cost is on HOA and not the city.
• Water run-off/drainage issues? - There will be no additional run-off into adjacent TH’s &
Homes.
• Communication process- Internally REC will create a neighbor email list and send out
updates. The frequency of this can be increased upon request by the neighbors. Our project
information can be found on the city of EP website. Our other comparable projects can be
found on our Ron Clark website.
Overall, most neighbors were supportive of the change in use of the property to Single Family. As
you can see most of the questions revolved around the process and the potential for noise, dust
and additional traffic during construction. Long term the change will make for a much more
cohesive area with all residential uses.
As previously indicated, we do not object to the proposed development plan. However, given our
proximity to the SAP property we are concerned that the noise pollution, dust and dirt from the
project will be a nuisance that significantly impacts the use and enjoyment of our home.
Ron Clark has indicated they will install a fence along the property line but has not indicated when
the fence will be installed. We requested that the fence be installed prior to the start of demolition.
Ron Clark has indicated that the demolition and infrastructure development will be conducted to
minimize the amount of dirt and dust produced by spraying water as necessary.
We understand that there will be significant noise pollution during all segments of the development
process. It’s our understanding that it’s likely that the decibel level from demolition and
infrastructure development, as well as the reverse beeping from construction equipment during all
phases, will likely exceed the allowable levels specified in the Minnesota Noise Pollution Control
Rules. We would appreciate it if the hours that equipment is operated or there is noise producing
building activity (e.g., framing work) be limited to Monday through Friday, and to cease by 5:00 PM
each day.
Ron Clark has indicated that the grade of the property will not be changed so as to increase water
flow on or under our property. Based on the drawing provided (Site Section 2, prepared by Whitten
Associates, Inc.) it appears that the grade will be higher than it currently is but we really can’t tell.
We request that the City monitor the traffic for speed and safety on Prairie Lakes Drive during all
phases of the construction process. The speed limit on Prairie Lakes Drive was recently increased
to 30 mph which did not make sense to us, especially now with this upcoming project.
Mark & Becky Kuck
10684 Leaping Deer Ln
Eden Prairie, MN 55344
From:City of Eden Prairie
To:Planning
Subject:*NEW SUBMISSION* Contact Us: Planning and Zoning
Date:Thursday, March 14, 2024 2:37:01 PM
Contact Us: Planning and Zoning
Submission #:3067296
IP Address:15.181.49.124
Submission Date:03/14/2024 2:36
Survey Time:7 minutes, 1 second
You have a new online form submission.
Note: all answers displaying "*****" are marked as sensitive and must be viewed after your login.
Please complete this form to provide comments or ask questions. Planning Division Eden Prairie City Center
8080 Mitchell Road 952-949-8485
Full Name
Mark Kuck
Email
kuckchalet@outlook.com
Full Address
10684 Leaping Deer Ln
Eden Prairie, MN 55344
Phone
(612) 578-6185
Message
We understand that Ron Clark Construction has submitted a proposal to develop the SAP site at 10700 Prairie Lakes
Drive. Our home in Weston Woods on Anderson Lakes is adjacent to the SAP site (the building is within 130 feet
from our home). We have sent Mike Waldo our questions in writing as we can't attend the proposed meeting. We
would like to send our comments to the planning commission as well. Can you please let us know who we can send
them to? Thank you, Mark & Becky Kuck
Would you like to be contacted regarding your comments?
Yes
How do you prefer we contact you?
Email
Thank you,
City of Eden Prairie
This is an automated message generated by Granicus. Please do not reply directly to this email.
CITY COUNCIL AGENDA
SECTION: Public Hearings
DATE:
May 7, 2024
DEPARTMENT/DIVISION:
Community Development/Planning
Julie Klima/Jeremy Barnhart
ITEM DESCRIPTION:
Asia Mall
ITEM NO.:
IX.C.
Requested Action
Move to:
• Close the Public Hearing; and
• Adopt a Resolution for a Planned Unit Development Concept Review on 4.69 acres; and
• Approve the 1st Reading of the Ordinance for a Planned Unit Development District Review with waivers on 4.69 acres; and
• Direct Staff to prepare a Development Agreement incorporating Staff and Commission recommendations and Council conditions; and
• Authorize the issuance of an early Land Alteration Permit for Asia Mall at the request of the Developer subject to the conditions outlined in the permit. Synopsis
Asia Mall opened in November 2022 and initial experience found that the amount of parking on site did not meet the business need. With the parking lot full, mall patrons were observed parking at adjacent private properties, and crossing Technology Drive causing safety concerns for both pedestrians and motorists.
The applicant is proposing an expansion of the surface parking lot, adding 122 spaces, increasing
the total number of spaces on site to 424. Most of this added parking is east of the existing entrance drive, replacing a stormwater pond. Stormwater management is proposed to be provided by an underground system. Site Plan The expansion of the parking lot includes a number of on site improvements, including:
• An extension of the red concrete pedestrian path into the new section of parking
• Additional landscaping replacing trees removed. Some of these new plantings
will provide screening and interest along the south edge of the parking lot
• A right turn deceleration lane into the site
• Stormwater management, treating additional water prior to entering Lake Idlewild
Planned Development Waivers
As a part of the PUD process, the applicant is seeking waivers to City Code requirements as outlined below. Number of parking spaces. The expansion increases the total number of parking spaces to 425, including 2 EV stalls in the
underground garage. The City Code requirement, based on the type of restaurants, number of seats, and the area of retail, is 445 spaces. The number of spaces represents 95% of the City Code requirement. Approval in 2020 waived parking to 76% of the requirement.
The applicant notes that the Institute of Traffic Engineers (ITE) publish a manual forecasting
parking demand. That manual suggests that 340-367 parking spaces are needed to meet the demand of the Mall. At the request of the Planning Commission, Asia Mall completed parking counts during weekday
and weekend evenings and weekend noon peak hours to verify actual parking demand. These
parking studies were completed April 25-28th. A second weekend of counts will be completed prior to the City Council meeting. Observed parking identified the peak hours of 1-2 and 2-3 pm on Saturdays, where 247 cars were parking on site, each hour. This weekend of demand shows that at peak, 82% of the lot is full.
Note that the number of parking spaces required by City Code reflects full occupancy of the Mall; approximately 1,900 sq ft of office/ retail space is vacant. Occupancy of these spaces will increase parking lot usage. Staff supports the waiver as it increases the parking provided to parking required ratios.
Parking islands (size and number) Based on the reconfiguration of the existing lot and new surface stalls, an additional 10 islands would be required and one island would need to be enlarged to meet the 160 sq ft minimum. To
maximize the number of parking stalls onsite, the applicant is requesting a waiver to not install or enlarge these 11 islands. Staff supports the waivers as much of the parking lot is screened
from external view.
Impervious surface The property is in the shoreland overlay district, and therefore limited to 30% impervious coverage. The site is currently at 69.41% consistent with the original site plan approval. With
the expansion of the surface lot, approximately 87% of the lot will be covered with impervious
surfaces (pavement/ roof, etc.). Staff supports the waiver as overall water quality goals can be achieved with an enhanced stormwater management system for this already non-conforming site. Setback
The parking lot as proposed extends into the required side yard (west side), and the front yards
(north and south). Staff supports these waivers as the open space goals of setbacks are preserved by the low likelihood of parcels to the north and west being developed. The property to the north is right of way and the property to the west is a substation owned by Xcel. Further, the reduced setback on the south matches the existing parking lot setback.
Sustainable Features Two EV charging stations were added with the original approval. Two more may be added in the future. The site will also include bike racks and will convert an existing impervious parking
island to a landscaped island consistent with City Code. Planning Commission Recommendation The Planning Commission voted 5-3 to recommend approval of the project at the March 25,
2024 meeting. Commissioners supported the project to maximize parking on site, subject to
conditions related to signage, and landscaping improvements. Those in opposition were concerned with the Mall’s ability to manage parking long term, and the lack of observed parking counts.
Attachments
1. Resolution for PUD Concept Review 2. Ordinance for PUD District Review with Waivers 3. Planning Commission Staff Report 4. Planning Commission Minutes
CITY OF EDEN PRAIRIE HENNEPIN COUNTY, MINNESOTA
RESOLUTION NO. 2024-___ A RESOLUTION APPROVING THE PLANNED UNIT DEVELOPMENT CONCEPT OF ASIAN PLAZA
FOR ASIAN PLAZA PROPERTY, LLC
WHEREAS, the City of Eden Prairie has by virtue of City Code provided for the Planned Unit Development (PUD) Concept of certain areas located within the City; and
WHEREAS, the Planning Commission did conduct a public hearing on April 8, 2024, on Asian Plaza by Asian Plaza Property, LLC and considered their request for approval of the PUD Concept Plan and recommended approval of the request to the City Council; and
WHEREAS, the City Council did consider the request on May 7, 2024.
NOW, THEREFORE, BE IT RESOLVED by the City Council of Eden Prairie, Minnesota, as follows:
1. Asian Plaza, being in Hennepin County, Minnesota, legally described as outlined
in Exhibit A, is attached hereto and made a part hereof (“Property”). 2. That the City Council does grant PUD Concept approval as outlined in the plans stamp dated March 22, 2024.
3. That the PUD Concept meets the recommendations of the Planning Commission dated April 8, 2024. ADOPTED by the City Council of the City of Eden Prairie this 7th day of May, 2024.
__________________________
Ronald A. Case, Mayor ATTEST:
__________________________
David Teigland, City Clerk
EXHIBIT A
PUD Concept
Legal Description: Lot 1, Block 1, Gander Mountain, Hennepin County, Minnesota.
Abstract Property
ASIAN PLAZA
CITY OF EDEN PRAIRIE HENNEPIN COUNTY, MINNESOTA ORDINANCE NO. -2024-PUD-_-2024
AN ORDINANCE OF THE CITY OF EDEN PRAIRIE, MINNESOTA, AMENDING THE DESIGNATION OF CERTAIN LAND WITHIN A ZONING DISTRICT AND ADOPTING BY REFERENCE CITY CODE CHAPTER 1 AND SECTION 11.99 WHICH, AMONG OTHER THINGS, CONTAIN PENALTY PROVISIONS
THE CITY COUNCIL OF THE CITY OF EDEN PRAIRIE, MINNESOTA, ORDAINS: Section 1. That the land which is the subject of this Ordinance (hereinafter, the “land”) is legally described in Exhibit A attached hereto and made a part hereof.
Section 2. That action was duly initiated proposing that the designation of the land be
amended within the C-REG-SER Zoning District as -2024-PUD-_-2024 (hereinafter "PUD-_-2024”). Section 3. The City Council hereby makes the following findings:
A. PUD-_-2024 is not in conflict with the goals of the Comprehensive Guide Plan of the City. B. PUD-_-2024 is designed in such a manner to form a desirable and unified
environment within its own boundaries.
C. The exceptions to the standard requirements of Chapters 11 and 12 of the City Code that are contained in PUD-_-2024 are justified by the design of the development described therein.
D. PUD-_-2024 is of sufficient size, composition, and arrangement that its construction, marketing, and operation are feasible as a complete unit without
dependence upon any subsequent unit.
Section 4. The proposal is hereby adopted and the designation of the land shall be, and hereby is amended in the C-REG-SER Zoning District as Planned Unit Development PUD-_-2024 and the legal descriptions of land in each district referred to in City Code Section 11.03,
subdivision 1, subparagraph B, shall be and are amended accordingly.
Section 5. The land shall be subject to the terms and conditions of that certain Development Agreement dated as of _____, 2024 entered into between Asian Plaza Property, LLC, and the City of Eden Prairie (hereinafter “Development Agreement”). The Development
Agreement contains the terms and conditions of PUD-_-2024, and are hereby made a part hereof.
Section 6. City Code Chapter 1 entitled “General Provisions and Definitions Applicable to the Entire City Code Including Penalty for Violation” and Section 11.99 entitled
“Violation a Misdemeanor” are hereby adopted in their entirety by reference, as though repeated
verbatim herein. Section 7. The City Council determines that publication of the title and a summary of this ordinance clearly informs the public of the intent and effect of the ordinance, and directs that
only the title of the ordinance and a summary attached as Exhibit B hereto be published, with
notice that a printed copy of the ordinance is available for inspection by any person during regular business hours at the office of the city clerk. Section 8. This Ordinance shall become effective from and after its passage and
publication.
FIRST READ at a regular meeting of the City Council of the City of Eden Prairie on the 7th Day of May, 2024, and finally read and adopted and ordered published in summary form as attached hereto at a regular meeting of the City Council of said City on the ___ day of ___, 2024.
ATTEST:
____________________________ ____________________________
David Teigland, City Clerk Ronald A. Case, Mayor
PUBLISHED in the Sun Sailor on _______________, 2024.
EXHIBIT A
PUD Legal Description Legal Description Lot 1, Block 1, Gander Mountain, Hennepin County, Minnesota. Abstract Property
TO: Planning Commission
FROM: Jeremy Barnhart, City Planner
DATE: April 8, 2024 SUBJECT: Asia Mall Parking lot expansion
LOCATION: 12160 Technology Drive REQUEST: • Planned Unit Development Concept Review on 4.69 acres
• Planned Unit Development District Amendment with waivers on 4.69 acres
• Site Plan approval on 4.69 acres
BACKGROUND In 2020, approval was granted for the reuse of the former Gander Mountain to Asia Mall, a two story
retail center with a ground level grocery story and restaurant spaces. Office and additional retail
uses also occupy the space. Asia Mall opened in November, 2022. After a short while, it because apparent that the parking did not meet the business need of the property. With the parking lot full, mall patrons were observed
parking at adjacent private properties, and crossing Technology Drive causing safety concerns for
both pedestrians and motorists. At the initial opening, in the holiday season and during a winter of heavy snows, a parking issue was identified. Since then, Mall ownership has sought ways to better manage the parking needs. During
periods of high business volume, additional security has been hired to direct traffic; snow will be
removed from parking spaces; and the construction of additional parking is proposed. As a longer term solution, the expansion requires land use approvals. SITE PLAN
The proposal is to replace an existing stormwater pond with surface parking and an underground
stormwater management system. The additional parking area would add 122 spaces,
primarily east of the main entrance,
Staff Report – Asia Mall Parking lot expansion
April 8, 2024 Page 2
2
where a right turn lane into the site is also added.
The existing pedestrian pathway of red concrete will be extended east into the new portion of the parking lot for added visibility and safety of pedestrians. The proposal includes additional landscaping and provides for additional parking lot lighting. PLANNED UNIT DEVELOPMENT WAIVERS
The following waivers are requested: Front yard (north, and south), side yard setback (west). A waiver has been granted for the existing parking lot to encroach into required front yard on the south. The proposal continues that
encroachment along the south property line providing for consistency in the site design.
Additionally, the proposed parking lot expansions encroach into the west and north required yards. These encroachments are supported because there will not be any further development of these areas and there is significant separation from the property and the large electrical transmission yard to the west, and an on-ramp to Interstate 494 to the north. Given these unique land uses, the goals of
minimum setbacks (separation of uses, provision of open space, etc.) are maintained.
Impervious Surface area. This property is within the shoreland overlay district, where the maximum impervious surface area is 30%. The site plan shows 97% impervious surface. Is it difficult to avoid impervious surface waivers in existing commercial/ retail environments. The shoreland regulations, including the impervious surface area limits, are intended to protect the
natural characteristics of the land, and the quality of the water body. In developed commercial environments, the natural quality is already compromised, so the primary goal shifts to minimizing the impervious surface and water quality. The stormwater management standards protect the water quality. Reducing impervious surface is not practical with the scope of this project due to many factors, including timing.
Staff Report – Asia Mall Parking lot expansion
April 8, 2024 Page 3
3
Parking. The existing and proposed uses of the building requires 445 parking spaces:
Current Proposal
ITE Parking Generation
Square feet Parking
stalls Weekday
peak
Saturday
Peak
Office 4,873 21.9 12 1
Non-grocery retail 5,218 23.5 12 17
Common space 12,560 25.1
Grocery 33,645 151.4 99 122
Type 1 Rest. 5,725 60.0 99 109
Type 2 Rest. 886 8.0 118 118
Type 3 Rest. 11,664 155.0
Parking required 74,571 445 340 367 Total parking provided is 424 spaces. While there is a parking deficit of 21 spaces, the site provides 95% of the code requirements based on the variety of uses. The original approval of Asia Mall granted a waiver to allow 76% of the required spaces, to 294 spaces.
The number of parking spaces provided exceeds the ITE suggested parking requirements for both Weekday and Saturday peaks. Parking islands (size and number). City Code requires one landscaped island per 20 stalls, each
island be 160 sq ft minimum, and the cumulative area of parking islands be equal or greater than 5% of the parking lot area. While overall the total area of parking lot islands exceeds the minimum standard, to meet the standard for the number and size of islands, at least 6 new islands would need to be added, and two proposed islands would need to be enlarged, resulting is 8 less parking spaces. In this situation, waivers are preferred to prevent off-site parking, as street
parking and parking on adjacent private parcels is not possible. TREE REPLACEMENT AND LANDSCAPING 39 trees will be removed to facilitate the parking lot expansion. It is the city’s practice that non-significant trees required of a previous approval be replaced at a ratio of 1:1. Other significant trees
will be replaced subject to the city’s tree replacement ordinance. A combination of planting of trees, shrubbery, and payment in lieu of tree replacement will satisfy these requirements. Upon completion of the project, 43 trees and 65 shrubs will be planted on site. The landscaping plan provided shows new trees and shrubbery along the south property line, east of
the main drive. Staff recommends these trees and shrubs be spaced out along the south property line,
Staff Report – Asia Mall Parking lot expansion
April 8, 2024 Page 4
4
to improve the streetscape interest along the entire frontage, rather than concentrated along a relatively small section of frontage. This is reasonable given the front yard setback waivers
requested. SIDEWALKS AND TRAILS There is currently no sidewalk along the north side of Technology Drive And there are no plans to
add a sidewalk or cross walk in the area. While there is a trail along the south side of Technology
Dr., any future construction of a crosswalk would need to be intentional to avoid introduction of an unsafe situation, or funneling patrons to private property. If one is added in the future, portions of these improvements are the responsibility of the property
owner. The development agreement will speak the property owner’s responsibilities.
DRAINAGE Stormwater will be managed with an underground system under the eastern addition of the parking lot. This system limits the ability to plan trees or other landscaping in the immediate area. The stormwater management system will conform to applicable regulations. SIGNS No additional signage is proposed, though the existing freestanding sign near the entrance will shift to the east. STAFF RECOMMENDATION Staff recommends approval of the site and the waivers as requested.
UNAPPROVED MINUTES
EDEN PRAIRIE PLANNING COMMISSION
MONDAY, APRIL 8, 2024 7:00 PM—CITY CENTER Council Chambers 8080 Mitchell Road
COMMISSION MEMBERS: John Kirk, Frank Sherwood, Andrew Pieper, Ed Farr, Trisha Duncan, Robert Taylor, Dan Grote, Charles Weber; Phou Sivilay CITY STAFF: Jeremy Barnhart, City Planner; Carter Schulze, City Engineer; Matt Bourne, Manager of Parks and Natural Resources; Kristin Harley, Recording Secretary I. CALL THE MEETING TO ORDER Chair Pieper called the meeting to order at 7:00 p.m.
II. PLEDGE OF ALLEGIANCE – ROLL CALL
Chuck Weber was absent. Chair Pieper welcomed new commission member Trisha
Duncan. III. APPROVAL OF AGENDA
MOTION: Kirk moved, seconded by Taylor to approve the agenda. MOTION
CARRIED 8-0.
IV. MINUTES
MOTION: Sherwood moved, seconded by Kirk to approve the minutes of February 12,
2023 with the change from “used access agreement” to “shared access agreement” on
Item V, page 2, paragraph four. MOTION CARRIED 8-0.
V. PUBLIC HEARINGS
A. ENCLAVE AT MANOR ROAD (2023-14) Request for
• PUD Concept Review of 6.43 acres
• PUD District Review with waivers on 6.43 acres
• Zoning Change from Rural to R1-9.5 on 6.43 acres
PLANNING COMMISSION MINUTES April 8, 2024
Page 2
• Preliminary Plat to divide one parcel into 17 lots and one outlot on 6.43 acres Chris Contreras, President of Brandl Anderson Homes displayed a PowerPoint and detailed the application. He introduced his company and described the setback waiver to conserve more of the trees. The development would create 17
lots and one outlot. The landscape plan utilized a tree replacement formula replacing as many as possible, and also to fill in with plantings as many as possible. The timeframe anticipated completion in June 2024, with sales in August-September and the last home and escrow completed by April 2026. The houses would range from 2,400 to 4,000 square feet and be priced in the Low
700s. They would have stone accents, increased roof pitches, smart siding instead of vinyl and would be EV and solar ready. The developer could offer one-level homes but the target buyer was two-story homes. Barnhart presented the staff report. This was a subdivision with a right-of-way
and an outlot for stormwater management on the northwest corner of the site. The lots were orientated on the extension of South Manor Road. This was a redevelopment of an existing farm which was not historic, but would nevertheless be documented by the Heritage Preservation Commission. A waiver requested a front yard setback reduction from 30 to 25, and the front yard along 168th would
be reduced to 20 feet. Along the north side of the road the lot width would be reduced from 70 feet to 65 feet. Staff supported these waivers to manage and maintain existing vegetation. They allowed more space in backyards away from grading and vegetation. The project would try to design around existing vegetation and stormwater treatment, and it was a challenge because of the soils
and slope. The corner outlot was best case scenario of the available option. The developer had a tree replacement plan and screening plan. Staff recommended approval subject to the conditions in the staff report. Ted Mellby of 11881 Germaine Terrace questioned why no commission members
had any questions of the developer. He asked if they had visited the site and stated he would circulate a photograph of the tree removal at Pioneer Trail and Dell Road. He hoped the photograph would move the commissioners to leave as many trees as possible. He stated could not understand the tree replacement formula and would be meeting with City staff regarding his concerns.
Adam Driscoll of 6411 Mere Drive stated he respected the rights of the building and property owners but urged the commission members to consider noise and traffic during the construction phase. He asked for hours of operation and contacts to limit noise and disturbance. He stated there had been numerous near-misses in
the neighborhood and requested that construction related traffic use the west side of the development.
PLANNING COMMISSION MINUTES April 8, 2024
Page 3
Patty Farris stated she lived on 168th adjacent to the outlot and this development
would ruin the salability of her house along with the views she enjoyed. It would
create an island with just her house on the side. A pipe would be put through her yard tearing up her driveway and she had no assurances of repair. Many of the trees saved would be buckthorn and box elder junk trees. She pleaded for a pause on the development for this month so she could ask the developers for an
alternative plan with the outlot in the subdivision itself. She invited the
commission members to visit her and visit the site. There was also conflicting messaging about the plan submitted by the Watershed District. She outlined an alternate design with an outlot that would be more attractive with a U-shaped roadway through it and lots based on smaller houses.
Marie Jackson, Patty Farris’s daughter, raised concerns about traffic on 168th as she had children and the street was already dangerous with no apparent speed limit.
Natalie Martin of 1657 South Manor Road stated there were along 168th no stop
signs, and she was concerned about traffic control with children and pets. The traffic study did not address the 17 additional houses with two drivers each and she asked how only 15 additional trips were the result. She requested there be traffic control at Mere Drive or some other alternative.
Paul Bloom of Manor Road echoed the traffic concerns with pets and children. Kate Olson of Manor Road raised issues related to the water management issue. She stated the developer in her area did not respect the water plan in the past and
she has had water issues in their yard for years. She asked how the City would
enforce this. Also she did not understand the zoning change, as the houses in the development seemed closer together than the zoning around it. MOTION: Grote moved, seconded by Taylor to close the public hearing. Motion
carried 8-0.
Sherwood asked for the speed limit for Eden Prairie on unmarked streets. Schulze replied it was 30 miles/hour. There was always a speed limit in Eden Prairie, whether posted or not.
Taylor asked what plans were there in place the ensure the outlot was suitable and would not cause the issues brought up. Schulze replied neighborhood did not have a lot of storm sewers to begin with so water flowed into low yards, particularly across 168th . There would be a separate area dry space where water would be
infiltrated per Watershed District requirements, running eventually into a pipe and
into the rest of the system. This would be an improvement from both the stormwater treatment and flooding perspective. It was meant to be a pond like other ponds in Eden Prairie, and the City would maintain the site. It had not been
PLANNING COMMISSION MINUTES April 8, 2024
Page 4
maintained because heretofore it had not been owned by the City. The water
would be captured and treated, improving the situation.
Pieper asked staff to address the traffic issues. Schulze replied this was not a highly recorded area for speed problems. At any rate, stop signs were not put in for speed control but to create right-of-way, and putting them in when not-
warranted was less safe on a long road. People would speed, and this could be
addressed by electric speed signs, more intersections condensed neighborhoods, parking on streets which naturally slowed traffic. More obstacles made streets safer and it was not common to have stop signs at every corner.
Farr stated he approved of the development which had many positive points.
Street connections offered more dispersion options rather than a funneling of traffic. It would conserve many trees. Eden Prairie had an aggressive tree conservation policy though the formula could be daunting. The City did a good job at allocating land for heritage trees in infill sites like this. The residents had a
fair expectation of the rules and regulation regarding construction hours of
operation and there would be phone numbers for residents to call. He added the applicant would have someone onsite every day. Farr added he supported the waivers.
Kirk stated with 15 years’ experience he had learned how developments evolved.
Eden Prairie had an established in-depth process for evaluating developers and all of this was looked at carefully. There were reasons for it. He wished to reemphasize what City Engineer Schulze said regarding the development which would improve traffic and water management and which provided sincere and
well-researched answers to staff. He found this to be a pretty well thought out
project, despite the challenges an infill project posed. He supported the development. Pieper echoed these sentiments and found the waivers to be minimal.
Farr added the outlot natural area was an amenity and planting nine or ten trees between Farris’s house and the pond would help. He urged Patty Farris to work with the developer on their placement.
Kirk asked staff to address the zoning. Barnhart replied R1 meant residential single family and 9.5 meant 9,500 square foot lot. The neighborhood to the east was zoned R1-9.5 and the neighborhood to the north and south were zoned R1-13.5 (13,500 square foot lots), and to the west R1-22 (22,000 square foot lots).
Duncan stated the residents’ comments were well-received and reiterated she heard major themes: traffic calming, water flow, zoning, and tree conservation. She did find the lots in the development appeared to be smaller than in the
PLANNING COMMISSION MINUTES April 8, 2024
Page 5
surrounding area. Sivilay added that higher priced homes would raise present
home values.
Taylor asked for and received confirmation the noise during construction would be limited to set weekday times and no pile driving would be taking place. Farr noted backup beeping was required by OSHA.
MOTION: Farr moved, seconded by Kirk to recommend PUD Concept Review of 6.43 acres, PUD District Review with waivers on 6.43 acres, Zoning Change from Rural to R1-9.5 on 6.43 acres, Preliminary Plat to divide one parcel into 17 lots and one outlot of 6.43 acres as represented in the April 8, 2024 staff report.
Motion carried 8-0.
B. LOTUS VILLAS ON ANDERSON LAKES (2024-02) Request for
• Guide Plan Change from Office to Low Density Residential on 5.0 acres
• PUD Concept Plan Review on 5.0 acres
• PUD District Review with waivers on 5.0 acres
• Zoning District Change from Office to R1-9.5 on 5.0 acres
• Preliminary Plan review on 5.0 acres
Mike Waldo with Ron Clark Construction displayed a PowerPoint and detailed
the application. He explained the hours of operation and that he had met with neighbors regarding noise and dust during construction. He displayed an area map with surrounding land use and explained it was previously zoned commercial.
Tim Witten, Witten Associates displayed the site plan showing the existing townhomes to the north and single-family residents to the south. He explained this was a transition project of detached single family homes. They had originally considered a mix of single and twin homes but after meeting with neighbors
decided on the villas. There would be 16 walkouts with full basements and three
in center slab on grade. He displayed the elevations and explained the benefits of a single developer/builder. Waldo explained the HOA would maintain driveways and do the mowing. There
would be a buffer easement instead of a drainage utility easement. The grading
plan would tie into berms from existing neighborhoods. Duncan asked for the demolition process. Waldo replied they would empty the building which would take two weeks or 12 working days. The materials would
be recycled and dust would be minimized with water.
PLANNING COMMISSION MINUTES April 8, 2024
Page 6
Barnhart presented the planning report. This was several requests to change the
land use from office to low density residential, a zoning change with waivers, a
PUD concept and district review with waivers, and Zoning Change and Preliminary Plat review, all on 5 acres. The project converted an existing office building into a 19-lot single family development. The villas were like a ‘detached’ townhome, with individual ownership of the unit, and HOA-maintained common
grounds, streets, and driveways.
Farr asked for and received confirmation the private drive at the north end terminated without a cul-de-sac and there were no concerns about firetruck access
Terry Pearson of 10827 Leaping Deer Lane stated her community (Weston
Woods) was very delighted about this project. She and President of the Board Joe Vorheck found the developer accessible and communicative. She asked Waldo to address the dirt, dust, and noise pollution and asked if the fence could be erected prior to construction.
Ted Mellby of 11881 Germaine Terrace distributed his photograph and referenced the loss of trees in this development. He urged the commission members suggest the arborist Miss Commers examine the site and calculate the environmental harm. He asked how many significant trees would be removed from this site and
noted the replacements would not come close to replacing the diameter of trees
lost. He also asked if there was a difference between a variance and a waiver. MOTION: Grote moved, seconded by Sherwood to close the public hearing. Motion carried 8-0.
Pieper asked staff to address the tree replacement. Barnhart replied the plan could be shared with Mellby and put on the City’s website. Staff did consider City Code and did consult with the Parks Department and the arborist in replacing these trees with smaller but better quality ones.
Sivilay asked for and received confirmation this development would not disrupt the neighboring communities. Waldo also explained there were no short-term rentals allowed. Also the arborist had been contacted directly and there would be an excess of trees in the final result. He would also meet with the residents
regarding the timing of the fencing. Taylor suggested a temporary fencing. Waldo agreed a silt fence was a possibility, but he did not want to order fencing before receiving an approval of his application by the City Council. Farr noted on the east side there were lots with decreasing frontage and asked if
these could be standardized. Waldo replied emergency overflow of water prevented this in that section. Pieper asked for and received confirmation the City would repair any street damage. Farr commended the development.
PLANNING COMMISSION MINUTES April 8, 2024
Page 7
MOTION: Kirk moved, seconded by Duncan to recommend approval for the
Guide Plan Change from Office to Low Density Residential on 5.0 acres, PUD
Concept Plan Review on 5.0 acres, PUD District Review with waivers on 5.0 acres, Zoning District Change from Office to R1-9.5 on 5.0 acres, and Preliminary Plat review on 5.0 acres as represented in the April 8, 2024 staff report. Motion carried 8-0.
C. ASIA MALL PARKING LOT EXPANSION (2024-01) Request for
• Planned Unit Development Concept Review on 4.69 acres
• Planned Unit District Amendment with waivers on 4.69 acres
• Site Plan Review on 4.69 acres
Lance Eliot of Eliot Design displayed a PowerPoint and detailed the application.
This mall was on the site of Gander Mountain. Parking stalls had been full and patrons had been forced to park across Technology Drive and cross that road to visit the site. Construction would start in summer by Amcon if approved. There were waivers to setback, impervious surface area, parking, and islands requested.
The application included landscaping and tree replacement and stormwater
improvements. He displayed the existing conditions and explained the area where the parking lot would be expanded. At present there was a 155-stall deficit. He displayed and explained the parking calculations. 445 were required, and 425 were being requested. There were 290 stalls currently. He displayed the tree
replacement plan and the parking islands and explained the stormwater treatment
plan. Sivilay agreed traffic was heavy especially on Sundays. He asked what vacancy was in the building and what industries were represented in the vacancies. Eliot
replied to his understanding the building was at full capacity, which was what the
traffic study was based on. There was a potential mezzanine that had not yet been constructed. Sivilay asked for and received confirmation this was the final parking plan.
Taylor asked if the developer could exceed safety capacity for the building. Eliot
replied the traffic study was based on a safe standard but more visitors to the building were beyond his control. Duncan asked for and received confirmation the new exit was exit only and there
would be lighting throughout the parking lot. There would be a sidewalk along the
length of the parking lot. Farr praised the popularity of this amenity. He found no visible signage directing drivers to the lower level parking. He disputed the applicant’s traffic counts,
which did not actually count cars from current usage. He stated there were four or
PLANNING COMMISSION MINUTES April 8, 2024
Page 8
five vacant storefronts when he visited the day before. Peak traffic movements
would give more accurate results than the manual. He asked how square footage
and restaurant seated contributed to the parking problem which already existed. Eliot replied he was not involved in the restaurant approval but the original proposal was based on the estimates at that time, and the difference was not significant. Farr stated the original application included a parking ramp. Eliot
replied there were challenges to building a parking ramp such as overhead power
lines and the expansion would not have adverse impacts. The stormwater pond would be difficult with a ramp. Farr suggested alternative stall striping to yield one-way instead of two-way aisles with 60-degree parking. Eliot replied this had been the first concept. The proposal was the best solution after several iterations.
Farr suggested pervious pavement alternatives, and Eliot agreed these were
originally part of his proposal but he was dissuaded by City staff who found the underground storage system a superior choice. Farr asked for a condition to restore the site to previous conditions should the parking need wane in the future. Eliot agreed to this condition upon talking with his clients.
Kirk asked for and received confirmation employees parked elsewhere and were brought in by bus. Eliot added that need would go away with the expansion but that service would still be provided if needed. Eliot conceded the parking problems were ongoing. He added the parking study did not include an actual
parking count but the peaks in the study closely matched the numbers onsite,
which actually yielded a deficit of 60 parking stalls. The proposal would yield 90 extra parking stalls, making a traffic count irrelevant. Kirk replied actual data was always preferable to estimated.
Pieper asked how many stalls were in the expansion, and Eliot replied there would
be 80. He suggested no constructing the right expansion, and Eliot replied it did not meet City Code. The point was to maximize the number of parking stalls with the least amount of impact. Farr noted this was essentially a replacement proof-of-parking plan asking for a higher total and stated he still distrusted the numbers.
Pieper commented on the signage that did not materialize. Kirk noted this was a
unique problem the commission members did not anticipate. He stated the parking needed to be put in now, and the original estimates exacerbated the problem. He agreed the message seemed to be to build for the future need, not a present need that would become inadequate. Pieper asked if there would be designated
employee parking spots and Eliot replied there would not be, nor compact parking, but he was open to discussing it. Sivilay commended the attempt to address the problem, but doubted this was a final plan. He asked if the original ramp had been looked into. Eliot replied cost
was not always relevant but the cost for a ramp was prohibitive for the number of stalls it would yield, though he had not personally looked into it. He found the parking expansion as a whole was the permanent solution. He agreed with additional signage to direct people to the lower level. Sivilay asked why the
PLANNING COMMISSION MINUTES April 8, 2024
Page 9
original plans were not followed. Eliot stated he could not answer this. Sivilay
asked how the present plans could be followed if the original ones weren’t. Eliot
replied he was working with City staff to ensure this. Barnhart added staff could look into all conditions not followed. Pieper asked for and received clarification this was a “permanent solution” to
meet the City cold rather than to actually meet peak demand. Eliot added the final
number of parking stalls would substantively exceed the need so both were met. Taylor asked if there was a calculation for disabled spaces, and Barnhart replied he did not have a number but it would be ADA-conforming.
Barnhart presented the staff report. He explained this was a unique site as there
were not many food court malls in Eden Prairie with no real opportunity for offsite parking. Staff tried to maximize the parking on the site which triggered waivers. This proposal reflected a balance of the Zoning Code with the big picture. It did not meet a strict reading of the Code but met the expected parking
demand and decreased the ratio parking from the original waiver. Staff
recommended approval based on conditions outlined in the staff report. Farr noted the “ghosted in” truck circulation plan did not provide an exit for delivery or fire trucks. Barnhart replied trucks exited the main entrance. Farr
added there were no landscape areas for snow storage with the additional parking
stalls up against lot lines. Barnhart replied the original agreement included trucking out the snow. Farr commented on the difference between retail and office parking. He warned against the customer becoming frustrated with this parking plan.
MOTION: Grote moved, seconded by Taylor to close the public hearing. Motion carried 8-0. Kirk stated the mall was a great addition to Eden Prairie and he wanted to see it
work, but see it work within safe and reasonable standards. The commission had
been behind the proof-of-parking plan from the beginning, which was apparently unrealistic. This had driven many waivers, which he was not enthusiastic about but found reasonable. He was frustrated about not using actual data, and he did not want to see the Planning Commission in this position again in the future. He
wished this business to thrive and to adequately deal with the stormwater. Despite his reservations he supported this proposal. Farr stated he agreed with Kirk including the reservations, and found he could not support this proposal. The total impact of the waivers could not make up for the
inability to provided adequate parking, which could require a reduction in demand. While he did not want that, it was the unspoken issue needing to be addressed.
PLANNING COMMISSION MINUTES April 8, 2024
Page 10
Pieper stated this business was a tremendous asset but he felt this proposal was
overbuilt while not using actual data. In this unique situation he was not sure the
commission should allow a build-to-Code and he liked Farr’s suggestion of a return to the original parking if demand decreased. He felt trepidation about this proposal and could not support it.
Grote asked if it was a reality that there was no more “build out” in Eden Prairie,
only “build up.” Duncan asked for and received clarification the impervious pavement was between 87 and 97 percent. The maximum permissible was 30 percent. Barnhart
would solidify the percentage before the application reached the City Council.
Duncan expressed concern that a delay in approval would cause the problem to persist. Farr replied the mall would have to address its parking problems, such as closing certain shops or altering the hours of operation. Taylor asked for and received clarification the City Council would vote on this, whether or not the
Planning Commission approved it. Kirk urged the commission members go on
record for the City Council. Pieper asked for and received confirmation Barnhard was comfortable with the peak use estimates.
MOTION: Kirk moved, seconded by Grote to recommend approval for Planned Unit Development Concept Review on 4.69 acres, Planned Unit District Amendment with waivers on 4.69 acres, and Site Plan Review on 4.69 acres as represented in the April 8, 2024 staff report. Motion carried 5-3 (with Sivilay,
Pieper, and Farr voting nay).
PLANNERS’ REPORT Barnhart stated he did not anticipate another meeting in April, and staff was working on a number of Ordinance Amendments the commission would see in
60-90 days. MEMBERS’ REPORTS
VI. ADJOURNMENT MOTION: Taylor moved, seconded by Kirk to adjourn. Motion carried 8-0. The meeting was adjourned at 9:38 p.m.
CITY COUNCIL AGENDA
SECTION: Payment of Claims
DATE:
May 07, 2024
DEPARTMENT/DIVISION:
Tammy Wilson, Office of the City Manager/Finance
ITEM DESCRIPTION:
Payment of Claims
ITEM NO.:
X.
Requested Action Move to: Approve the Payment of Claims as submitted (roll call vote)
Synopsis Checks 308426 - 308874
Wire Transfers 1035799 - 1035923 Wire Transfers 10348 - 10415
City of Eden PrairieCouncil Check Summary
5/7/2024
Division Amount Division Amount
000 General 533 601 Prairie Village Liquor 144,281
100 City Manager 68,362 602 Den Road Liquor 288,863
101 Legislative 351 603 Prairie View Liquor 172,508
102 Legal Counsel 39,730 605 Den Road Building 1,959
110 City Clerk 284 701 Water Enterprise Fund 291,318
111 Customer Service 8,791 702 Wastewater Enterprise Fund 414,964
112 Human Resources 42 703 Stormwater Enterprise Fund 154,467
114 Benefits & Training 6,409 Total Enterprise Fund 1,468,360
130 Assessing 250
131 Finance 3,374 802 494 Commuter Services 62,189
132 Housing and Community Services 37,002 806 SAC Agency Fund 59,640
133 Planning 124 807 Benefits Fund 1,587,268
136 Public Safety Communications 2,799 809 Investment Fund 4,996
137 Economic Development 107 811 Property Insurance 8,161
151 Park Maintenance 68,911 812 Fleet Internal Service 231,482
153 Organized Athletics 2,789 813 IT Internal Service 93,257
154 Community Center 42,944 815 Facilites Operating ISF 40,896
156 Youth Programs 8,189 816 Facilites City Center ISF 66,863
158 Senior Center 815 817 Facilites Comm. Center ISF 112,414
159 Recreation Administration 7,340 818 Dental Insurance 27,595
160 Therapeutic Recreation 1,000 820 Fencing Consortium 229,764
162 Arts 647 Total Internal Svc/Agency Funds 2,524,525
163 Outdoor Center 700
168 Arts Center 250 Report Total 4,709,119
180 Police Sworn 23,602
184 Fire 20,111
186 Inspections 3,576
201 Street Maintenance 9,451
202 Street Lighting 80,651
Total General Fund 439,133
301 CDBG 499
303 Cemetary Operation 240
Total Special Revenue Fund 739
308 E-911 437
315 Economic Development 1,111
502 Park Development 29,390
509 CIP Fund 29,056
513 CIP Pavement Management 24,182
522 Improvement Projects 2006 24,487
526 Transportation Fund 32,126
539 2020 Improvement Projects 99,419
541 Dell Rd (Crestwood to CSAH 61)36,151
804 100 Year History 5
Total Captial Projects Fund 276,363
City of Eden PrairieCouncil Check Register by GL
5/7/2024
Check #Amount Supplier / Explanation Account Description Business Unit Comments308544383,901 METROPOLITAN COUNCIL MCES User Fee Wasterwater Collection Wastewater Svc Fee May 2024
10352 348,992 HEALTHPARTNERS Health Insurance Health and Benefits Premiums April 2024
10413 304,663 UKG INC Federal Taxes Withheld Health and Benefits Payroll Taxes PR Ending 04.19.24
10380 304,515 UKG INC Federal Taxes Withheld Health and Benefits Payroll Taxes PR Ending 04.05.24
308494 229,764 ARX PERIMETERS Other Contracted Services Fencing Consortium Fences, Gates, Doors Apr24 - Mar25
10378 224,715 PUBLIC EMPLOYEES RETIREMENT ASSOCIATION PERA Health and Benefits PERA PR Ending 03.22.24
10411 224,043 PUBLIC EMPLOYEES RETIREMENT ASSOCIATION PERA Health and Benefits PERA PR Ending 04.05.24
10377 136,175 MINNESOTA DEPT OF REVENUE Due to Other Governments Various Funds Sales Tax March 2024
308576 122,243 MINGER CONSTRUCTION INC Improvement Contracts Stormwater Capital Priority Pond Dredging Project
1035871 105,247 XCEL ENERGY Electric Various Funds Multi premise Electric
308677 97,200 JAG GROUP, LLC Right of Way & Easement 2020 Improvement Projects
1035857 94,521 BOYER TRUCKS Autos Fleet Capital
1035923 80,374 XCEL ENERGY Electric Various Funds
308545 59,044 METROPOLITAN COUNCIL Due to Other Governments SAC Agency Fund
1035918 52,268 SRF CONSULTING GROUP INC Design & Engineering Transportation Fund
308843 50,463 NATIONAL AUTO FLEET GROUP Autos Fleet Capital
1035905 41,144 GREGERSON ROSOW JOHNSON & NILAN LTD Legal Legal Criminal Prosecution
308532 38,580 HYDROCORP Improvement Contracts Water Enterprise Fund
10415 36,774 EMPOWER Deferred Compensation Health and Benefits
1035895 36,151 WSB & ASSOCIATES INC Design & Engineering Dell Rd (Crestwood to CSAH 61)
10382 35,513 EMPOWER Deferred Compensation Health and Benefits
308571 34,020 UKG INC Ultimate (prev. Ceridian)IT Operating
308490 29,553 AMERICAN LIBERTY CONSTRUCTION, INC Improvement Contracts Water Enterprise Fund
308834 29,390 ISG Other Contracted Services Park Development
10364 29,322 CARD CONNECT Bank and Service Charges Community Center Admin
308857 26,930 SOUTH METRO PUBLIC SAFETY TRAINING FACIL Other Contracted Services Public Safety Training Facilit
308833 26,876 HYDROCORP Improvement Contracts Water Enterprise Fund
1035822 26,831 DIVERSE BUILDING MAINTENANCE Janitor Service Various Funds
308816 26,678 CUSTOM HOME BUILDERS TITLE LLC Deposits General Fund
1035859 24,852 CENTERPOINT ENERGY Gas Various Funds
1035900 24,753 DIVERSE BUILDING MAINTENANCE Janitor Service Various Funds
1035903 24,487 GMH ASPHALT CORPORATION Improvement Contracts Improvement Projects 2006
308859 22,128 STANTEC CONSULTING SERVICES INC OCS - Studies Stormwater Capital
308497 21,918 BADGER METER Telephone Water Metering
308456 21,303 JOHNSON BROTHERS LIQUOR CO Liquor Product Received Den Road Liquor Store
308499 21,220 BEAUDRY OIL & PROPANE Motor Fuels Fleet Operating
10355 20,993 NCR PAYMENT SOLUTIONS,PA, LLC Bank and Service Charges Liquor Stores
10353 19,145 WEX HSA - Employer Health and Benefits
308867 19,108 U.S DEPARTMENT OF AGRICULTURE Other Contracted Services Deer Consultant
308804 19,078 AUDIO LOGIC SYSTEMS Building Repair & Maint.Capital Maint. & Reinvestment
10381 18,981 ICMA RETIREMENT TRUST-457 Deferred Compensation Health and Benefits
10414 18,890 ICMA RETIREMENT TRUST-457 Deferred Compensation Health and Benefits
308762 18,610 BREAKTHRU BEVERAGE MN BEER LLC Liquor Product Received Den Road Liquor Store
10393 18,231 WEX HSA - Employee Health and Benefits
308448 18,155 BREAKTHRU BEVERAGE MN BEER LLC Liquor Product Received Den Road Liquor Store
308768 18,039 JOHNSON BROTHERS LIQUOR CO Liquor Product Received Den Road Liquor Store
308709 16,698 PRAIRIEVIEW RETAIL LLC Building Rental Prairie View Liquor Store
308837 16,351 LANO EQUIPMENT INC Equipment Parts Capital Outlay Parks
10383 16,078 PAYCHEX Wages and Benefits MM 494 Corridor Commission
Check #Amount Supplier / Explanation Account Description Business Unit Comments1038516,078 PAYCHEX Wages and Benefits MM 494 Corridor Commission
308666 14,893 GRAYMONT Treatment Chemicals Water Treatment
1035899 14,520 CENTERPOINT ENERGY Gas City Center - CAM
10363 14,216 CHASE Bank and Service Charges Various Funds
308434 13,785 JOHNSON BROTHERS LIQUOR CO Liquor Product Received Prairie Village Liquor Store
10384 13,775 U.S. BANK - I-494 PURCH. CARD Various 494 Corridor Commission
308731 13,596 TYLER TECHNOLOGIES INC Software Maintenance IT Operating
308668 12,646 GRI EDEN PRAIRIE, LLC Building Rental Prairie Village Liquor Store
308462 12,051 SOUTHERN GLAZER'S WINE AND SPIRITS OF MN Liquor Product Received Den Road Liquor Store
308854 11,904 SAMBATEK INC Design & Engineering Wastewater Capital
308591 11,546 JOHNSON BROTHERS LIQUOR CO Liquor Product Received Den Road Liquor Store
308775 11,310 SOUTHERN GLAZER'S WINE AND SPIRITS OF MN Liquor Product Received Den Road Liquor Store
308500 11,087 BOLTON & MENK INC Other Contracted Services Water Capital
308787 10,668 JOHNSON BROTHERS LIQUOR CO Liquor Product Received Prairie View Liquor Store
308714 10,375 PROP Other Contracted Services Housing and Community Service
308600 10,206 SOUTHERN GLAZER'S WINE AND SPIRITS OF MN Liquor Product Received Den Road Liquor Store
308748 9,910 JOHNSON BROTHERS LIQUOR CO Liquor Product Received Prairie Village Liquor Store
308537 9,880 KORTERRA, INC OCS - Utility Locates Water Distribution
308574 9,859 VERIZON WIRELESS Data Plans - Police IT Operating
1035917 9,625 SENIOR COMMUNITY SERVICES Other Contracted Services Housing and Community Service
308470 9,542 BREAKTHRU BEVERAGE MN BEER LLC Liquor Product Received Prairie View Liquor Store
308478 9,444 JOHNSON BROTHERS LIQUOR CO Liquor Product Received Prairie View Liquor Store
308824 9,430 FIRE SAFETY USA INC Equipment Parts Fleet Operating
308764 9,215 CAPITOL BEVERAGE SALES LP Liquor Product Received Den Road Liquor Store
1035825 9,159 ESRI Software IT Operating
308684 9,075 MACQUEEN EQUIPMENT INC Equipment Repair & Maint Fleet Operating
10371 8,855 HEALTHPARTNERS Dental Insurance Dental Insurance
308782 8,757 BREAKTHRU BEVERAGE MN BEER LLC Liquor Product Received Prairie View Liquor Store
10349 8,530 BPAS HRA Health and Benefits
308838 8,161 LEAGUE MN CITIES INS TRUST Insurance Property Insurance
308628 7,858 BREAKTHRU BEVERAGE MN BEER LLC Liquor Product Received Prairie View Liquor Store
308525 7,692 GRAYMONT Treatment Chemicals Water Treatment
308522 7,654 EXCEL LAWN & LANDSCAPE Contract Svcs - Lawn Maint.City Center - CAM
308827 7,480 GRAYMONT Treatment Chemicals Water Treatment
308582 7,463 BREAKTHRU BEVERAGE MN WINE & SPIRITS Liquor Product Received Den Road Liquor Store
308581 7,417 BREAKTHRU BEVERAGE MN BEER LLC Liquor Product Received Den Road Liquor Store
308743 7,349 BREAKTHRU BEVERAGE MN BEER LLC Liquor Product Received Prairie Village Liquor Store
308818 7,319 DG MINNESOTA CS 2021 LLC Electric Facilities Operating ISF
308669 7,062 HAMMER COMMUNITY SOLAR LLC Electric Facilities Operating ISF
308716 7,054 RECREATION SUPPLY CO Capital Under $25,000 Pool Operations
308635 6,837 JOHNSON BROTHERS LIQUOR CO Liquor Product Received Prairie View Liquor Store
1035883 6,824 BRAUN INTERTEC CORPORATION Contract Svcs - Asphalt/Concr.CIP Pavement Management
308763 6,802 BREAKTHRU BEVERAGE MN WINE & SPIRITS Liquor Product Received Den Road Liquor Store
308711 6,703 PRECISION UTILITIES Equipment Repair & Maint Water Distribution
308832 6,516 HENNEPIN COUNTY TREASURER Licenses, Taxes, Fees Stormwater Non-Capital
10392 6,436 HEALTHPARTNERS Dental Insurance Dental Insurance
308723 6,398 SSI KEF SLB LLC Electric City Center - CAM
308829 6,385 GYM WORKS Equipment Repair & Maint Fitness Center
308872 6,258 XIGENT SOLUTIONS LLC Hardware - R&M IT Capital
308721 6,250 SOJOURNER PROJECT INC.Other Contracted Services Police Sworn
308732 6,174 VALLEY RICH CO INC Capital Under $25,000 Outdoor Center Facilities
308491 6,121 AMERICAN WATER WORKS ASSOCIATION Dues & Subscriptions Utility Operations - General
308849 6,120 PRECISION UTILITIES Equipment Repair & Maint Water Distribution
Check #Amount Supplier / Explanation Account Description Business Unit Comments3087605,797 ARTISAN BEER COMPANY Liquor Product Received Den Road Liquor Store
10404 5,795 HEALTHPARTNERS Dental Insurance Dental Insurance
308673 5,765 HINTERLAND CSG LLC Electric Facilities Operating ISF
308807 5,648 BIRCH ENERGY Motor Fuels Fleet Operating
308648 5,515 APPLE FORD SHAKOPEE Equipment Repair & Maint Fleet Operating
1035864 5,322 LITTLE FALLS MACHINE INC Equipment Parts Fleet Operating
1035915 5,310 PIONEER ATHLETICS Operating Supplies Park Maintenance
1035906 5,235 HAWKINS INC Treatment Chemicals Water Treatment
1035896 5,128 YOUNGSTEDTS COLLISION CENTER Equipment Repair & Maint Fleet Operating
308482 5,079 SOUTHERN GLAZER'S WINE AND SPIRITS OF MN Liquor Product Received Prairie View Liquor Store
308440 5,014 SOUTHERN GLAZER'S WINE AND SPIRITS OF MN Liquor Product Received Prairie Village Liquor Store
308706 4,996 PFM ASSET MANAGEMENT LLC Interest Investment Fund
308460 4,869 PHILLIPS WINE AND SPIRITS INC Liquor Product Received Den Road Liquor Store
308641 4,865 SOUTHERN GLAZER'S WINE AND SPIRITS OF MN Liquor Product Received Prairie View Liquor Store
308720 4,828 SOBANIA COMMUNITY SOLAR Electric Facilities Operating ISF
10372 4,802 INVOICE CLOUD INC Bank and Service Charges Various Funds
308738 4,712 WM CORPORATE SERVICES INC Waste Disposal Various Funds
308681 4,653 LAW ENFORCEMENT LABOR SERVICES INC.Union Dues Withheld Health and Benefits
308724 4,644 SSI KEF SLB LLC Electric Water Treatment
10351 4,596 HEALTHPARTNERS Dental Insurance Dental Insurance
308736 4,560 WAYNES HOME SERVICES Window Washing Various Funds
308449 4,503 BREAKTHRU BEVERAGE MN WINE & SPIRITS Liquor Product Received Den Road Liquor Store
308621 4,503 SOUTHERN GLAZER'S WINE AND SPIRITS OF MN Liquor Product Received Prairie Village Liquor Store
308853 4,485 SAMBATEK INC Improvement Contracts Water Capital
308670 4,468 HEALTHPARTNERS Wages and Benefits MM 494 Corridor Commission
308527 4,413 HEALTHPARTNERS Dental Insurance Dental Insurance
308520 4,397 EDINA/EDEN PRAIRIE EXPLORERS Miscellaneous Volunteers
308538 4,364 LEGACY GYMNASTICS Instructor Service Recreational Sports
308783 4,317 BREAKTHRU BEVERAGE MN WINE & SPIRITS Liquor Product Received Prairie View Liquor Store
308450 4,154 CAPITOL BEVERAGE SALES LP Liquor Product Received Den Road Liquor Store
308517 4,125 EDEN PRAIRIE EARLY CHILDHOOD Other Contracted Services Housing and Community Service
308606 4,003 BREAKTHRU BEVERAGE MN WINE & SPIRITS Liquor Product Received Prairie Village Liquor Store
308614 3,961 JOHNSON BROTHERS LIQUOR CO Liquor Product Received Prairie Village Liquor Store
308792 3,955 SOUTHERN GLAZER'S WINE AND SPIRITS OF MN Liquor Product Received Prairie View Liquor Store
308508 3,938 CLIFTONLARSONALLEN LLP Other Contracted Services Organizational Services
1035867 3,887 METRO SALES INCORPORATED*Equipment Rentals IT Operating
308555 3,825 PDQ.COM Software Maintenance IT Operating
308480 3,799 PHILLIPS WINE AND SPIRITS INC Liquor Product Received Prairie View Liquor Store
308847 3,738 PALADIN TECHNOLOGIES Equipment Repair & Maint Facilities Staff
308830 3,707 HEALTH STRATEGIES Health & Fitness Fire
308733 3,698 VAN PAPER COMPANY Cleaning Supplies General Community Center
308626 3,667 ARTISAN BEER COMPANY Liquor Product Received Prairie View Liquor Store
308428 3,624 BREAKTHRU BEVERAGE MN BEER LLC Liquor Product Received Prairie Village Liquor Store
308784 3,595 CAPITOL BEVERAGE SALES LP Liquor Product Received Prairie View Liquor Store
308802 3,563 ASPEN MILLS Postage Fire
308596 3,562 PHILLIPS WINE AND SPIRITS INC Liquor Product Received Den Road Liquor Store
308507 3,479 CITYGATE ASSOCIATES LLC Other Contracted Services Capital Maint. & Reinvestment
1035921 3,348 WALL TRENDS INC Contract Svcs - General Bldg Den Road Liquor Store
308773 3,337 PHILLIPS WINE AND SPIRITS INC Liquor Product Received Den Road Liquor Store
308541 3,333 LOCKRIDGE GRINDAL NAUEN PLLP Legal Transportation Fund
308695 3,330 NEWTON RES, LLC Reimburse-legal notices General Fund
308826 3,321 FORESTRY DISTRIBUTING Landscape Materials/Supp Reforestation
308741 3,301 ARTISAN BEER COMPANY Liquor Product Received Prairie Village Liquor Store
Check #Amount Supplier / Explanation Account Description Business Unit Comments3086793,289 KREMER SERVICES LLC Equipment Repair & Maint Fleet Operating
308548 3,286 MINNESOTA VALLEY ELECTRIC COOPERATIVE Electric Street Lighting
308640 3,217 PHILLIPS WINE AND SPIRITS INC Liquor Product Received Prairie View Liquor Store
308674 3,208 HLS OUTDOOR Chemicals Park Maintenance
308561 3,125 RELATE COUNSELING CENTER Other Contracted Services Housing and Community Service
308530 3,100 HILDI INC Audit & Financial Various Funds
308671 3,077 HENNEPIN COUNTY ACCOUNTS RECEIVABLE Board of Prisoner Police Sworn
308506 3,000 CITY OF EDEN PRAIRIE FIRE RELIEF Deposits General Fund
308559 3,000 PITNEY BOWES BANK INC RESERVE ACCOUNT Postage Customer Service
308739 3,000 YMCA OF THE NORTH Other Contracted Services Housing and Community Service
308577 2,944 ARTISAN BEER COMPANY Liquor Product Received Den Road Liquor Store
308864 2,925 TRANSPORTATION COLLABORATIVE & CONSULTAN Deposits General Fund
308755 2,917 SOUTHERN GLAZER'S WINE AND SPIRITS OF MN Liquor Product Received Prairie Village Liquor Store
308683 2,915 LEGACY GYMNASTICS Instructor Service Recreational Sports
1035850 2,884 KRISS PREMIUM PRODUCTS INC Supplies - HVAC City Center - CAM
308745 2,879 CAPITOL BEVERAGE SALES LP Liquor Product Received Prairie Village Liquor Store
1035898 2,814 BIFFS INC Waste Disposal Park Maintenance
308583 2,811 CAPITOL BEVERAGE SALES LP Liquor Product Received Den Road Liquor Store
308722 2,789 SPORTS IMPORTS INC Capital Under $25,000 Volleyball
308665 2,770 FOURTEEN FOODS Reimburse-legal notices General Fund
308605 2,730 BREAKTHRU BEVERAGE MN BEER LLC Liquor Product Received Prairie Village Liquor Store
308707 2,663 PIRTEK BURNSVILLE Repair & Maint. Supplies Wasterwater Collection
308588 2,604 HOHENSTEINS INC Liquor Product Received Den Road Liquor Store
308454 2,573 HOHENSTEINS INC Liquor Product Received Den Road Liquor Store
1035902 2,558 ELECTRIC PUMP Repair & Maint. Supplies Wastewater Lift Station
308601 2,557 WINE MERCHANTS INC Liquor Product Received Den Road Liquor Store
308560 2,550 PRO TREE OUTDOOR SERVICES Other Contracted Services Tree Removal
308630 2,541 CAPITOL BEVERAGE SALES LP Liquor Product Received Prairie View Liquor Store
308753 2,493 PHILLIPS WINE AND SPIRITS INC Liquor Product Received Prairie Village Liquor Store
308501 2,475 BOOSHIE INC Clothing & Uniforms Emergency Management
1035855 2,456 ANCHOR PAPER COMPANY Office Supplies Customer Service
308650 2,439 ARVIG Telephone IT Operating
308797 2,411 AIRGAS USA LLC Supplies - Pool Pool Maintenance
1035849 2,376 GOODIN COMPANY Supplies - Pool Pool Maintenance
308531 2,375 HOMELINE Other Contracted Services Housing and Community Service
308563 2,340 SHADYWOOD TREE EXPERTS INC Other Contracted Services Tree Removal
308551 2,334 NORTH SHORE CONTRACTORS Fire Hydrant Permits Water Enterprise Fund
308556 2,307 PERA Wages and Benefits KT 494 Corridor Commission
308848 2,307 PERA Wages and Benefits MM 494 Corridor Commission
308744 2,306 BREAKTHRU BEVERAGE MN WINE & SPIRITS Liquor Product Received Prairie Village Liquor Store
308433 2,224 HOHENSTEINS INC Liquor Product Received Prairie Village Liquor Store
308780 2,212 ARTISAN BEER COMPANY Liquor Product Received Prairie View Liquor Store
308550 2,200 NORATEK SOLUTIONS INC Software Maintenance IT Operating
308554 2,125 ONWARD EDEN PRAIRIE Other Contracted Services Housing and Community Service
308498 2,114 BCM ONE Telephone IT Operating
308667 2,111 GREAT LAKES COCA-COLA DISTRIBUTION Merchandise for Resale Concessions
1035829 2,109 MENARDS Repair & Maint. Supplies Various Funds
308476 2,076 HOHENSTEINS INC Liquor Product Received Prairie View Liquor Store
308429 2,048 BREAKTHRU BEVERAGE MN WINE & SPIRITS Liquor Product Received Prairie Village Liquor Store
308430 2,004 CAPITOL BEVERAGE SALES LP Liquor Product Received Prairie Village Liquor Store
308812 2,000 CITY OF SAINT PAUL Tuition Reimbursement/School Police Sworn
308717 1,996 RICHFIELD PRINTING INC Office Supplies Customer Service
308800 1,975 AQUA LOGIC INC Contract Svcs - Pool Pool Maintenance
Check #Amount Supplier / Explanation Account Description Business Unit Comments3085721,974 US SPECIALTY COATINGS Repair & Maint. Supplies Water Distribution
308471 1,973 BREAKTHRU BEVERAGE MN WINE & SPIRITS Liquor Product Received Prairie View Liquor Store
1035804 1,940 BELLBOY CORPORATION Liquor Product Received Den Road Liquor Store
308718 1,926 SHADYWOOD TREE EXPERTS INC Other Contracted Services Tree Removal
308629 1,911 BREAKTHRU BEVERAGE MN WINE & SPIRITS Liquor Product Received Prairie View Liquor Store
308549 1,875 MOVEFWD INC Other Contracted Services Housing and Community Service
308779 1,860 WINE MERCHANTS INC Liquor Product Received Den Road Liquor Store
10376 1,854 WEX FSA - Medical Health and Benefits
10408 1,849 WEX FSA - Medical Health and Benefits
308661 1,794 CUMMINS SALES AND SERVICE Equipment Parts Fleet Operating
308619 1,793 PHILLIPS WINE AND SPIRITS INC Liquor Product Received Prairie Village Liquor Store
308447 1,792 ARTISAN BEER COMPANY Liquor Product Received Den Road Liquor Store
308458 1,786 PAUSTIS & SONS COMPANY Liquor Product Received Den Road Liquor Store
308725 1,725 SSI KEF SLB LLC Electric Maintenance Facility
308524 1,714 FIRE SAFETY USA INC Equipment Parts Fleet Operating
308647 1,670 ADS ON BOARDS Contract Svcs - Ice Rink Ice Arena Maintenance
1035821 1,641 CDW GOVERNMENT INC.Computers - Monitors IT Operating
308604 1,624 ARTISAN BEER COMPANY Liquor Product Received Prairie Village Liquor Store
308542 1,598 MACQUEEN EQUIPMENT INC Equipment Parts Fleet Operating
10350 1,592 FIDELITY SECURITY LIFE INSURANCE CO Vision Plan Health and Benefits
308444 1,584 WINE MERCHANTS INC Liquor Product Received Prairie Village Liquor Store
308809 1,570 BOUND TREE MEDICAL LLC EMS Supplies-EMS Supplies Fire
308585 1,566 DOMACE VINO Liquor Product Received Den Road Liquor Store
308439 1,550 PHILLIPS WINE AND SPIRITS INC Liquor Product Received Prairie Village Liquor Store
1035890 1,524 LYNDALE PLANT SERVICES Contract Svcs - Int. Landscape City Center - CAM
308789 1,510 PHILLIPS WINE AND SPIRITS INC Liquor Product Received Prairie View Liquor Store
10379 1,506 UKG INC Garnishment Withheld Health and Benefits
1035827 1,496 HORIZON COMMERCIAL POOL SUPPLY Supplies - Pool Pool Maintenance
1035862 1,472 GENUINE PARTS COMPANY Repair & Maint. Supplies Fleet Operating
1035842 1,450 WINE COMPANY, THE Liquor Product Received Den Road Liquor Store
308633 1,443 HOHENSTEINS INC Liquor Product Received Prairie View Liquor Store
308808 1,440 BLOOMINGTON, CITY OF Other Contracted Services Police Sworn
308663 1,436 FIRE SAFETY USA INC Equipment Repair & Maint Fleet Operating
10412 1,434 UKG INC Garnishment Withheld Health and Benefits
308651 1,416 ASPEN MILLS Clothing & Uniforms Fire
308873 1,415 YORKTOWN OFFICES Rent 494 Corridor Commission
1035826 1,370 GRAINGER Repair & Maint. Supplies City Center - CAM
308786 1,369 HOHENSTEINS INC Liquor Product Received Prairie View Liquor Store
308475 1,362 GREAT LAKES COCA-COLA DISTRIBUTION Liquor Product Received Prairie View Liquor Store
10362 1,352 WEX FSA - Medical Health and Benefits
308514 1,350 COUNTY MATERIALS CORPORATION Repair & Maint. Supplies Wasterwater Collection
308710 1,350 PRECISE MRM LLC Other Contracted Services Snow & Ice Control
10367 1,334 AMERICAN EXPRESS Bank and Service Charges Various Funds
308747 1,324 HOHENSTEINS INC Liquor Product Received Prairie Village Liquor Store
308611 1,315 HOHENSTEINS INC Liquor Product Received Prairie Village Liquor Store
1035886 1,280 FASTENAL COMPANY Equipment Parts Traffic Signs
308652 1,263 AUDIO LOGIC SYSTEMS Equipment Repair & Maint Fitness Classes
308855 1,261 SCHERER BROTHERS LUMBER CO Building Materials Park Maintenance
1035838 1,254 WINE COMPANY, THE Liquor Product Received Prairie Village Liquor Store
308523 1,244 FERGUSON WATERWORKS Safety Supplies Utility Operations - General
308495 1,137 ASPEN MILLS Clothing & Uniforms Fire
1035841 1,133 BELLBOY CORPORATION Liquor Product Received Den Road Liquor Store
308850 1,120 PRINCIPAL FINANCIAL GROUP Wages and Benefits KT 494 Corridor Commission
Check #Amount Supplier / Explanation Account Description Business Unit Comments3087661,120 HOHENSTEINS INC Liquor Product Received Den Road Liquor Store
308540 1,100 LIFE SUPPORT INNOVATIONS Other Contracted Services Street Maintenance
308713 1,100 PROGRESS SOFTWARE CORPORATION Hardware - R&M IT Operating
308799 1,100 AMERICAN ENVIRONMENTAL LLC Equipment Repair & Maint Wasterwater Collection
308851 1,100 PRO TREE OUTDOOR SERVICES Other Contracted Services Tree Removal
1035830 1,099 METRO SALES INCORPORATED*Equipment Rentals IT Operating
308607 1,080 CAPITOL BEVERAGE SALES LP Liquor Product Received Prairie Village Liquor Store
308856 1,074 SOLUTION BUILDERS Computers 494 Corridor Commission
308785 1,070 CLEAR RIVER BEVERAGE CO Liquor Product Received Prairie View Liquor Store
308595 1,062 PAUSTIS & SONS COMPANY Liquor Product Received Den Road Liquor Store
308586 1,060 GREAT LAKES COCA-COLA DISTRIBUTION Liquor Product Received Den Road Liquor Store
308861 1,059 SYSCO WESTERN MINNESOTA Merchandise for Resale Concessions
308543 1,042 MARCO INC Hardware - R&M IT Operating
1035892 1,041 SUMMIT FIRE PROTECTION Operating Supplies Fire
1035910 1,036 MENARDS Supplies - General Bldg Fire
1035911 1,016 METRO ELEVATOR INC Equipment Repair & Maint Water Treatment
308815 1,003 COREMARK METALS Operating Supplies Fleet Operating
308687 1,000 MERGE LLC Other Contracted Services Inclusion
308505 986 CINTAS CORPORATION Safety Supplies Community Center Admin
308852 985 RIVERS EDGE CONCRETE Pavement Rehab Miller Park
308765 977 CLEAR RIVER BEVERAGE CO Liquor Product Received Den Road Liquor Store
1035818 976 TOLL GAS AND WELDING SUPPLY Operating Supplies Fleet Operating
308871 975 WORTHINGTON MATT Tuition Reimbursement/School Organizational Services
308862 972 THE ADVENT GROUP Temp 494 Corridor Commission
1035907 971 HORIZON COMMERCIAL POOL SUPPLY Supplies - Pool Pool Maintenance
308729 955 THE ADVENT GROUP Temp 494 Corridor Commission
308468 951 ARTISAN BEER COMPANY Liquor Product Received Prairie View Liquor Store
308593 950 MEGA BEER Liquor Product Received Den Road Liquor Store
1035840 941 VINOCOPIA Liquor Product Received Den Road Liquor Store
308820 932 DODGE OF BURNSVILLE Equipment Parts Fleet Operating
10360 932 WEX FSA - Medical Health and Benefits
308451 927 CLEAR RIVER BEVERAGE CO Liquor Product Received Den Road Liquor Store
308697 920 NOW MICRO INC Miscellaneous Police Sworn
308746 919 CLEAR RIVER BEVERAGE CO Liquor Product Received Prairie Village Liquor Store
308798 910 AMAZING ATHLETES OF CENTRAL MN Instructor Service Recreational Sports
308835 908 JOHN HENRY FOSTER MINNESOTA INC Contract Svcs - General Bldg Maintenance Facility
308682 900 LEAST SERVICES COUNSELING Other Contracted Services Police Sworn
308534 876 J&W INSTRUMENTS INC Safety Supplies Utility Operations - General
1035916 873 PRAIRIE ELECTRIC COMPANY Equipment Repair & Maint Maintenance Facility
308831 867 HENNEPIN COUNTY I/T DEPT Equipment Repair & Maint Public Safety Communications
308643 866 WINE MERCHANTS INC Liquor Product Received Prairie View Liquor Store
308479 863 PAUSTIS & SONS COMPANY Liquor Product Received Prairie View Liquor Store
308822 862 EMERGENCY AUTOMOTIVE TECHNOLOGY INC Equipment Parts Fleet Operating
308672 850 HENNEPIN COUNTY FIRE CHIEF ASSOC Training Fire
308488 848 AIRGAS USA LLC Contract Svcs - Pool Pool Maintenance
308553 844 NOW MICRO INC Miscellaneous Police Sworn
1035824 843 ELECTRIC PUMP Repair & Maint. Supplies Wastewater Lift Station
308437 837 PAUSTIS & SONS COMPANY Liquor Product Received Prairie Village Liquor Store
308539 833 LEXISNEXIS RISK SOLUTIONS FL INC Other Contracted Services Police Sworn
308590 825 INSIGHT BREWING COMPANY LLC Liquor Product Received Den Road Liquor Store
308654 813 BOUND TREE MEDICAL LLC EMS Supplies Fire
308546 810 MGX EQUIPMENT SERVICES LLC Equipment Parts Fleet Operating
308819 795 DIESEL COMPONENTS, INC.Equipment Parts Fleet Operating
Check #Amount Supplier / Explanation Account Description Business Unit Comments10394792WEXHSA - Employer Health and Benefits
308568 791 TECH ACUMEN INCORPORATED Other Contracted Services Liquor Store Delivery
10410 770 MINNESOTA DEPT OF REVENUE Motor Fuels Fleet Operating
308759 765 WINE MERCHANTS INC Liquor Product Received Prairie Village Liquor Store
308461 750 RISE RIGHT LLC Liquor Product Received Den Road Liquor Store
1035880 731 BELLBOY CORPORATION Liquor Product Received Prairie View Liquor Store
308794 728 WINE MERCHANTS INC Liquor Product Received Prairie View Liquor Store
1035863 717 GRAINGER Office Supplies Facilities Staff
308646 715 ACME TOOLS Repair & Maint. Supplies Utility Operations - General
10400 715 WEX FSA - Medical Health and Benefits
1035816 701 SITEONE LANDSCAPE SUPPLY, LLC Repair & Maint. Supplies Park Maintenance
308693 700 MINT CONDITION DETAILING INC Equipment Repair & Maint Fleet Operating
308796 689 AHO BEVERLY Developer Fees General Fund
1035852 688 METROPOLITAN FORD Equipment Parts Fleet Operating
308465 682 WINE MERCHANTS INC Liquor Product Received Den Road Liquor Store
308426 662 ARTISAN BEER COMPANY Liquor Product Received Prairie Village Liquor Store
308472 660 CAPITOL BEVERAGE SALES LP Liquor Product Received Prairie View Liquor Store
1035844 654 VINOCOPIA Liquor Product Received Prairie View Liquor Store
308660 653 CORE & MAIN Repair & Maint. Supplies Street Maintenance
308569 653 THE ADVENT GROUP Temp 494 Corridor Commission
1035904 634 GRAINGER Repair & Maint. Supplies Water Treatment
308442 626 UNMAPPED BREWING CO Liquor Product Received Prairie Village Liquor Store
308841 625 MARTIN-MCALLISTER Employment Support Test Organizational Services
1035820 612 ASPEN WASTE SYSTEMS INC.Waste Disposal Various Funds
10373 610 WEX FSA - Medical Health and Benefits
1035837 610 BELLBOY CORPORATION Liquor Product Received Prairie Village Liquor Store
308459 609 PEQUOD DISTRIBUTION Liquor Product Received Den Road Liquor Store
1035801 603 BELLBOY CORPORATION Liquor Product Received Prairie Village Liquor Store
308690 600 MINNESOTA DEPT OF LABOR AND INDUSTRY Licenses, Taxes, Fees Fire Station #1
10356 599 US BANK - CREDIT CARD MERCHANT ONLY Bank and Service Charges Inspections-Administration
308874 595 ZOHO CORP Software Maintenance IT Operating
308767 590 INSIGHT BREWING COMPANY LLC Liquor Product Received Den Road Liquor Store
1035914 583 NORTH CENTRAL LABORATORIES Laboratory Chemicals Water Treatment
308772 573 PAUSTIS & SONS COMPANY Liquor Product Received Den Road Liquor Store
10398 564 WEX FSA - Medical Health and Benefits
308467 561 56 BREWING LLC Liquor Product Received Prairie View Liquor Store
1035860 560 DREW'S CONCESSIONS LLC Merchandise for Resale Concessions
1035887 559 GOPHER STATE ONE-CALL OCS - Utility Locates Water Distribution
1035897 552 ANCHOR PAPER COMPANY Office Supplies Customer Service
1035865 548 MENARDS Building Materials Snow & Ice Control
308749 547 LUPULIN BREWING COMPANY Liquor Product Received Prairie Village Liquor Store
1035845 544 BELLBOY CORPORATION Liquor Product Received Prairie View Liquor Store
308632 540 DOMACE VINO Liquor Product Received Prairie View Liquor Store
308639 538 PAUSTIS & SONS COMPANY Liquor Product Received Prairie View Liquor Store
1035893 534 THE OASIS GROUP Employee Assistance Organizational Services
1035873 525 BELLBOY CORPORATION Liquor Product Received Prairie Village Liquor Store
1035909 519 LOCATORS & SUPPLIES INC Operating Supplies Traffic Signals
308566 519 SUBURBAN CHEVROLET Equipment Parts Fleet Operating
308529 519 HIGHVIEW PLUMBING INC Contract Svcs - Plumbing Senior Center
308597 517 PRYES BREWING COMPANY Liquor Product Received Den Road Liquor Store
1035813 510 CUSTOM HOSE TECH Equipment Repair & Maint Fleet Operating
10375 508 WEX FSA - Medical Health and Benefits
308631 503 CLEAR RIVER BEVERAGE CO Liquor Product Received Prairie View Liquor Store
Check #Amount Supplier / Explanation Account Description Business Unit Comments308770491MEGA BEER Liquor Product Received Den Road Liquor Store
308438 487 PEQUOD DISTRIBUTION Liquor Product Received Prairie Village Liquor Store
308618 484 PAUSTIS & SONS COMPANY Liquor Product Received Prairie Village Liquor Store
308616 483 MAVERICK WINE LLC Liquor Product Received Prairie Village Liquor Store
308473 476 CLEAR RIVER BEVERAGE CO Liquor Product Received Prairie View Liquor Store
308686 469 MEDICINE LAKE TOURS Special Event Fees Trips
10348 469 PMA FINANCIAL NETWORK INC Bank and Service Charges Various Funds
1035919 468 STREICHERS Clothing & Uniforms Police Sworn
308828 467 GREAT LAKES COCA-COLA DISTRIBUTION Merchandise for Resale Concessions
308662 449 DODGE OF BURNSVILLE Equipment Parts Fleet Operating
308868 449 VAN PAPER COMPANY Cleaning Supplies Fire Station #1
1035834 443 XCEL ENERGY Electric Traffic Signals
308803 440 ASSURED SECURITY Building Repair & Maint.Park Maintenance
308623 435 WINE MERCHANTS INC Liquor Product Received Prairie Village Liquor Store
308515 433 DIGGINS NICHOLE DAY Conference/Prof. Dev.494 Corridor Commission
308769 433 LUPULIN BREWING COMPANY Liquor Product Received Den Road Liquor Store
308638 427 MODIST BREWING COMPANY Liquor Product Received Prairie View Liquor Store
308846 424 OXYGEN SERVICE COMPANY EMS Supplies-Oxygen Supplies Fire
308627 422 BLUE CLOUD DISTRIBUTION OF MINNESOTA INC Liquor Product Received Prairie View Liquor Store
308578 421 BERGMAN LEDGE LLC Liquor Product Received Den Road Liquor Store
308680 418 LAKE COUNTRY DOOR LLC Contract Svcs - General Bldg Fire Station #1
308740 416 PETTY CASH-POLICE DEPT Office Supplies Police Sworn
1035913 412 MINNESOTA EQUIPMENT Equipment Parts Fleet Operating
308726 407 ST CROIX LINEN LLC Operating Supplies-Linens Fire
10359 406 WEX FSA - Medical Health and Benefits
308617 405 MODIST BREWING COMPANY Liquor Product Received Prairie Village Liquor Store
308533 400 J H LARSON COMPANY Supplies - Pool Pool Maintenance
1035808 400 NEW FRANCE WINE COMPANY Liquor Product Received Prairie View Liquor Store
1035807 385 BELLBOY CORPORATION Liquor Product Received Prairie View Liquor Store
308825 381 FIRE-END & CROKER CORP Small Tools Fire
308790 375 RISE RIGHT LLC Liquor Product Received Prairie View Liquor Store
308649 373 ARAMARK Janitor Service Prairie Village Liquor Store
1035888 370 GREATAMERICA FINANCIAL SVCS Postage Customer Service
1035869 369 STREICHERS Clothing & Uniforms Police Sworn
1035806 368 VINOCOPIA Liquor Product Received Prairie View Liquor Store
308823 365 FASTSIGNS Operating Supplies Traffic Signs
308688 357 MINNESOTA AIR INC Supplies - HVAC Cummins Grill House
308592 355 MAVERICK WINE LLC Liquor Product Received Den Road Liquor Store
308573 352 VAN PAPER COMPANY Cleaning Supplies General Community Center
10406 352 WEX FSA - Medical Health and Benefits
308637 349 MAVERICK WINE LLC Liquor Product Received Prairie View Liquor Store
308840 349 MACQUEEN EQUIPMENT INC Lubricants & Additives Fleet Operating
308788 346 PAUSTIS & SONS COMPANY Liquor Product Received Prairie View Liquor Store
1035877 343 BELLBOY CORPORATION Liquor Product Received Den Road Liquor Store
308493 337 ARCPOINT LABS OF EDINA Employment Support Test Organizational Services
308435 329 MAVERICK WINE LLC Liquor Product Received Prairie Village Liquor Store
308858 325 ST CROIX LINEN LLC Operating Supplies-Linens Fire
308860 320 STAPLES ADVANTAGE Office Supplies Customer Service
308584 315 CLEAR RIVER BEVERAGE CO Liquor Product Received Den Road Liquor Store
1035805 312 NEW FRANCE WINE COMPANY Liquor Product Received Den Road Liquor Store
308870 310 WM CORPORATE SERVICES INC Waste Disposal Maintenance Facility
308811 309 CENTURYLINK Telephone E-911 Program
308602 301 WINEBOW Liquor Product Received Den Road Liquor Store
Check #Amount Supplier / Explanation Account Description Business Unit Comments308754300RISE RIGHT LLC Liquor Product Received Prairie Village Liquor Store
308821 300 DRAG N FLY WIRELESS INC Software Maintenance IT Operating
1035870 299 VARITECH INDUSTRIES INC Equipment Parts Fleet Operating
308474 299 ELM CREEK BREWING COMPANY Liquor Product Received Prairie View Liquor Store
10388 298 US BANK - PAYMODE Bank and Service Charges Finance
308751 297 MEGA BEER Liquor Product Received Prairie Village Liquor Store
1035814 297 METROPOLITAN FORD Equipment Parts Fleet Operating
308634 294 INBOUND BREW CO Liquor Product Received Prairie View Liquor Store
308642 294 UNMAPPED BREWING CO Liquor Product Received Prairie View Liquor Store
308452 293 DANGEROUS MAN BREWING CO LLC Liquor Product Received Den Road Liquor Store
1035866 290 METRO ELEVATOR INC Contract Svcs - Elevator City Center - CAM
308565 290 STAPLES ADVANTAGE Office Supplies Housing and Community Service
308758 287 VENN BREWING COMPANY Liquor Product Received Prairie Village Liquor Store
308624 275 WINEBOW Liquor Product Received Prairie Village Liquor Store
10370 272 WEX FSA - Medical Health and Benefits
308805 269 BATTERIES PLUS BULBS Repair & Maint. Supplies Police Sworn
308795 267 AG SPRAY EQUIPMENT Equipment Parts Fleet Operating
308608 267 CLEAR RIVER BEVERAGE CO Liquor Product Received Prairie Village Liquor Store
1035858 266 CDW GOVERNMENT INC.Computers IT Operating
1035810 263 BARNUM GATE SERVICES INC Contract Svcs - General Bldg Moss Site
308793 262 STEEL TOE BREWING LLC Liquor Product Received Prairie View Liquor Store
308806 260 BEAUDRY OIL & PROPANE Motor Fuels Fleet Operating
308486 259 WINEBOW Liquor Product Received Prairie View Liquor Store
1035861 257 ECM PUBLISHERS INC Legal Notices Publishing City Clerk
308817 256 DELTA DENTAL Wages and Benefits MM 494 Corridor Commission
308612 253 INBOUND BREW CO Liquor Product Received Prairie Village Liquor Store
308487 251 WOODEN HILL BREWING COMPANY LLC Liquor Product Received Prairie View Liquor Store
308708 250 PIZZA KARMA Operating Supplies Arts Center
308810 249 CATALYST GRAPHICS INC Advertising Wine Club/Events
10397 249 WEX FSA - Medical Health and Benefits
1035836 248 VINOCOPIA Liquor Product Received Prairie Village Liquor Store
308620 248 RED BULL DISTRIBUTING COMPANY INC Liquor Product Received Prairie Village Liquor Store
10369 247 WEX FSA - Medical Health and Benefits
308516 245 DIRECTV Cable TV Community Center Admin
308431 245 CLEAR RIVER BEVERAGE CO Liquor Product Received Prairie Village Liquor Store
308484 242 VENN BREWING COMPANY Liquor Product Received Prairie View Liquor Store
10395 241 VANCO SERVICES Bank and Service Charges Various Funds
10399 241 WEX FSA - Medical Health and Benefits
308678 239 JOHNSON LITHO GRAPHICS OF EAU CLAIRE LTD Printing Arts
308761 238 BARREL THEORY BEER COMPANY Liquor Product Received Den Road Liquor Store
308518 237 EDEN PRAIRIE NOON ROTARY CLUB Miscellaneous Housing and Community Service
308625 236 WOODEN HILL BREWING COMPANY LLC Liquor Product Received Prairie Village Liquor Store
308865 231 TRANSUNION RISK & ALTERNATIVE DATA Other Contracted Services Police Sworn
308603 230 WOODEN HILL BREWING COMPANY LLC Liquor Product Received Den Road Liquor Store
1035803 230 SHAMROCK GROUP, INC - ACE ICE Liquor Product Received Den Road Liquor Store
308446 228 ARBEITER BREWING COMPANY LLC Liquor Product Received Den Road Liquor Store
10366 225 BPAS HRA Health and Benefits
308774 225 RISE RIGHT LLC Liquor Product Received Den Road Liquor Store
1035872 221 VINOCOPIA Liquor Product Received Prairie Village Liquor Store
308432 218 DANGEROUS MAN BREWING CO LLC Liquor Product Received Prairie Village Liquor Store
308750 218 MAVERICK WINE LLC Liquor Product Received Prairie Village Liquor Store
308589 211 INBOUND BREW CO Liquor Product Received Den Road Liquor Store
308801 207 ARAMARK Janitor Service Prairie View Liquor Store
Check #Amount Supplier / Explanation Account Description Business Unit Comments10396207DELUXEBank and Service Charges Senior Center Admin
308615 207 LUPULIN BREWING COMPANY Liquor Product Received Prairie Village Liquor Store
308777 207 STEEL TOE BREWING LLC Liquor Product Received Den Road Liquor Store
1035843 206 SHAMROCK GROUP, INC - ACE ICE Liquor Product Received Prairie View Liquor Store
1035848 206 CUSTOM HOSE TECH Equipment Parts Fleet Operating
308492 205 ARAMARK Janitor Service Prairie View Liquor Store
10358 204 WEX FSA - Medical Health and Benefits
1035819 203 TOWNSEND BRETT Clothing & Uniforms Police Sworn
10391 201 OPTUM HEALTH Other Contracted Services Health and Benefits
308567 194 SYSCO WESTERN MINNESOTA Merchandise for Resale Concessions
10389 194 WEX FSA - Medical Health and Benefits
308778 192 VENN BREWING COMPANY Liquor Product Received Den Road Liquor Store
308510 190 COMCAST Internet IT Operating
308771 188 MODIST BREWING COMPANY Liquor Product Received Den Road Liquor Store
308613 185 INSIGHT BREWING COMPANY LLC Liquor Product Received Prairie Village Liquor Store
308570 184 TIMESAVER OFF SITE SECRETARIAL INC Other Contracted Services City Council
308781 184 BARREL THEORY BEER COMPANY Liquor Product Received Prairie View Liquor Store
308609 183 DOMACE VINO Liquor Product Received Prairie Village Liquor Store
308443 180 VENN BREWING COMPANY Liquor Product Received Prairie Village Liquor Store
308519 180 EDEN PRAIRIE ROTARY CLUB Dues & Subscriptions Administration
308535 177 JOHNSTONE SUPPLY Supplies - HVAC Outdoor Center Facilities
1035868 176 SHERWIN WILLIAMS CO Repair & Maint. Supplies Park Maintenance
308866 175 TWIN CITY MONUMENT CO Other Contracted Services Pleasant Hill Cemetery
308436 174 MODIST BREWING COMPANY Liquor Product Received Prairie Village Liquor Store
308427 172 BARREL THEORY BEER COMPANY Liquor Product Received Prairie Village Liquor Store
308469 172 BARREL THEORY BEER COMPANY Liquor Product Received Prairie View Liquor Store
1035912 171 METRO SALES INCORPORATED*Printers -Accessories IT Operating
308742 168 BARREL THEORY BEER COMPANY Liquor Product Received Prairie Village Liquor Store
308863 167 TIMESAVER OFF SITE SECRETARIAL INC Other Contracted Services City Council
308477 166 INVICTUS BREWING CO Liquor Product Received Prairie View Liquor Store
308727 165 TECH ACUMEN INCORPORATED Other Contracted Services Liquor Store Delivery
1035876 163 VINOCOPIA Liquor Product Received Den Road Liquor Store
1035879 163 VINOCOPIA Liquor Product Received Prairie View Liquor Store
308481 162 RED BULL DISTRIBUTING COMPANY INC Liquor Product Received Prairie View Liquor Store
308842 160 MR CUTTING EDGE Contract Svcs - Ice Rink Ice Arena Maintenance
308453 159 DOMACE VINO Liquor Product Received Den Road Liquor Store
308664 159 FORLITI SOPHIA Operating Supplies Winter Theatre
308698 157 PAFFY'S PEST CONTROL Contract Svcs - Pest Control Outdoor Center Facilities
10390 156 WEX FSA - Medical Health and Benefits
1035884 154 CONCRETE CUTTING AND CORING Equipment Repair & Maint Utility Operations - General
1035920 150 USA SECURITY Maintenance Contracts Water Treatment
10403 148 WEX FSA - Medical Health and Benefits
308464 144 VENN BREWING COMPANY Liquor Product Received Den Road Liquor Store
308594 144 MODIST BREWING COMPANY Liquor Product Received Den Road Liquor Store
1035828 144 JANEX INC Cleaning Supplies General Community Center
308715 142 PROP Other Contracted Services CDBG - Public Service
308653 140 BLUE LINE CUSTOM GIFTS Operating Supplies Police Sworn
308463 139 STEEL TOE BREWING LLC Liquor Product Received Den Road Liquor Store
308483 139 STEEL TOE BREWING LLC Liquor Product Received Prairie View Liquor Store
1035802 139 NEW FRANCE WINE COMPANY Liquor Product Received Prairie Village Liquor Store
308719 137 SHRED RIGHT Waste Disposal City Center - CAM
1035889 136 KAPAUN, RYAN Tuition Reimbursement/School Police Sworn
10405 135 WEX FSA - Medical Health and Benefits
Check #Amount Supplier / Explanation Account Description Business Unit Comments308791135SAINT CROIX VINEYARDS, INC.Liquor Product Received Prairie View Liquor Store
308656 135 CENTURYLINK Internet IT Operating
308485 134 WINE MERCHANTS INC Liquor Product Received Prairie View Liquor Store
308836 133 JOHNSON JUSTIN Travel Expense Fire
308536 132 JW PEPPER & SON INC Operating Supplies Community Band
1035831 131 SHERWIN WILLIAMS CO Repair & Maint. Supplies Park Maintenance
308466 131 WOODEN HILL BREWING COMPANY LLC Liquor Product Received Den Road Liquor Store
1035874 131 NEW FRANCE WINE COMPANY Liquor Product Received Prairie Village Liquor Store
308457 130 MODIST BREWING COMPANY Liquor Product Received Den Road Liquor Store
308813 129 COMCAST Telephone E-911 Program
308445 126 WINEBOW Liquor Product Received Prairie Village Liquor Store
308587 126 HEADFLYER BREWING Liquor Product Received Den Road Liquor Store
308610 126 HEADFLYER BREWING Liquor Product Received Prairie Village Liquor Store
308552 126 NORTHERN TOOL Repair & Maint. Supplies Utility Operations - General
308712 125 PRESNELL EDWARD M JR Other Contracted Services Senior Center Programs
1035882 124 BARNHART JEREMY Travel Expense Planning
308564 123 SOLUTION BUILDERS Computers 494 Corridor Commission
308575 122 WM CORPORATE SERVICES INC Waste Disposal Fire Station #3
1035881 120 PARLEY LAKE WINERY Liquor Product Received Prairie View Liquor Store
1035846 120 CARLSON, THOR Travel Expense Police Sworn
1035853 120 NESSLER STEVEN Travel Expense Police Sworn
1035854 120 WILLIAMSON SCOTT Travel Expense Police Sworn
1035823 117 ECM PUBLISHERS INC Legal Notices Publishing City Clerk
308579 116 BLUE CLOUD DISTRIBUTION OF MINNESOTA INC Liquor Product Received Den Road Liquor Store
308598 116 SHAKOPEE BREWHALL Liquor Product Received Den Road Liquor Store
308839 114 LIFETIME FITNESS P&R Refunds Community Center Admin
308599 113 SMALL LOT MN Liquor Product Received Den Road Liquor Store
1035835 113 SHAMROCK GROUP, INC - ACE ICE Liquor Product Received Prairie Village Liquor Store
308752 112 PAUSTIS & SONS COMPANY Liquor Product Received Prairie Village Liquor Store
308644 111 WOODEN HILL BREWING COMPANY LLC Liquor Product Received Prairie View Liquor Store
10374 111 WEX FSA - Medical Health and Benefits
10357 107 PAYA Bank and Service Charges Winter Theatre
1035851 107 LINDAHL, DAVID Mileage & Parking Economic Development
308757 105 STEEL TOE BREWING LLC Liquor Product Received Prairie Village Liquor Store
308756 104 STARRY EYED BREWING LLC Liquor Product Received Prairie Village Liquor Store
308776 104 STARRY EYED BREWING LLC Liquor Product Received Den Road Liquor Store
308441 103 STEEL TOE BREWING LLC Liquor Product Received Prairie Village Liquor Store
308511 103 COMCAST Cable TV Fire
10401 92 WEX FSA - Medical Health and Benefits
308645 92 M-R SIGN CO INC Signs Traffic Signs
10361 90 WEX FSA - Medical Health and Benefits
308503 90 CENTURYLINK Telephone IT Operating
308622 88 VIP WINE & SPIRITS LTD Liquor Product Received Prairie Village Liquor Store
1035885 85 FADDEN, TIMOTHY Licenses, Taxes, Fees Inspections-Administration
308659 84 COMCAST Cable TV Fire
308558 83 PILGRIM DRY CLEANERS INC Clothing & Uniforms Police Sworn
1035891 82 MUNOZ, MEGAN Mileage & Parking Fitness Admin.
308696 80 NORGREN STEVEN Building Materials Street Maintenance
10387 78 PAYCHEX Payroll Admin. Fees 494 Corridor Commission
10409 78 PAYCHEX Payroll Admin. Fees 494 Corridor Commission
1035800 75 VINOCOPIA Liquor Product Received Prairie Village Liquor Store
1035901 74 ECM PUBLISHERS INC Legal Notices Publishing City Clerk
308513 74 CORE & MAIN Repair & Maint. Supplies Park Maintenance
Check #Amount Supplier / Explanation Account Description Business Unit Comments30867672IEDITWEB INC Licenses, Taxes, Fees Garden Room Repairs
308502 72 BOUND TREE MEDICAL LLC EMS Supplies Fire
308636 69 LUPULIN BREWING COMPANY Liquor Product Received Prairie View Liquor Store
308509 68 COMCAST Cable TV Fire
1035815 66 SACKETT, MATTHEW Clothing & Uniforms Police Sworn
1035847 65 CONCRETE CUTTING AND CORING Equipment Repair & Maint Street Maintenance
308734 65 VANHAUER KRISTINA P&R Refunds Community Center Admin
308580 63 BOOM ISLAND BREWING COMPANY Liquor Product Received Den Road Liquor Store
10386 61 MONEY MOVERS INC Other Contracted Services Community Center Admin
1035812 60 CRASSAS TRACIE Tuition Reimbursement/School Fitness Classes
308735 57 VESSCO INC Repair & Maint. Supplies Water Treatment
308557 54 PETER MANOS AR Utility Water Enterprise Fund
308658 51 COMCAST Internet IT Operating
308526 50 GUPTA PRASHANT P&R Refunds Community Center Admin
308675 50 HOFFMAN MARK Other Contracted Services Assessing
308694 50 MOQUIST, LYNDON Other Contracted Services Assessing
308728 50 TESSMANN, STEVE Other Contracted Services Assessing
308730 50 THOMPSON NATE Other Contracted Services Assessing
308737 50 WERDAL SCOTT Other Contracted Services Assessing
1035811 50 CHANSKI DAN Clothing & Uniforms Police Sworn
10365 49 WEX FSA - Medical Health and Benefits
308685 48 MAMAC SYSTEMS INC Supplies - HVAC General Community Center
308496 47 ASSURED SECURITY Supplies - General Bldg Fire Station #1
308489 47 ALMOKAYYAD MARIAM P&R Refunds Community Center Admin
308869 46 VERMONT SYSTEMS, INC Software Recreation Admin
1035839 46 SHAMROCK GROUP, INC - ACE ICE Liquor Product Received Den Road Liquor Store
308562 45 REMMES NICHOLAS Mileage & Parking Aquatics Admin.
1035908 45 LANDS END CORPORATE SALES Clothing & Uniforms Police Sworn
1035875 44 SHAMROCK GROUP, INC - ACE ICE Liquor Product Received Den Road Liquor Store
1035832 42 UPS Postage Human Resources
1035878 35 SHAMROCK GROUP, INC - ACE ICE Liquor Product Received Prairie View Liquor Store
10402 35 WEX FSA - Medical Health and Benefits
308844 35 NOW MICRO INC Computers IT Operating
1035809 35 AMERICAN SOLUTIONS FOR BUSINESS Operating Supplies Recreation Admin
1035799 34 SHAMROCK GROUP, INC - ACE ICE Liquor Product Received Prairie Village Liquor Store
308512 34 CORDER TRICIA Tuition Reimbursement/School Fitness Classes
308521 31 EMERGENCY AUTOMOTIVE TECHNOLOGY INC Equipment Parts Fleet Operating
308547 26 MINNESOTA TROPHIES & GIFTS Operating Supplies Park Maintenance
1035894 25 TOLL GAS AND WELDING SUPPLY Repair & Maint. Supplies Utility Operations - General
308691 24 MINNESOTA TROPHIES & GIFTS Operating Supplies Police Sworn
308689 23 MINNESOTA DEPT OF HEALTH Conference/Training Utility Operations - General
1035817 22 SPOK, INC.Cell/Pager Plans IT Operating
308814 21 CORE & MAIN Repair & Maint. Supplies Park Maintenance
308504 20 CHRIS CASTLE INC Phone/Data/Web 494 Corridor Commission
1035856 18 BOBBY & STEVE'S AUTO WORLD EDEN PRAIRIE Equipment Repair & Maint Police Sworn
308692 15 MINNESOTA VALLEY ELECTRIC COOPERATIVE Electric Various Funds
308845 14 OPHOVEN SAW SERVICE Equipment Repair & Maint Senior Center Programs
10407 12 WEX FSA - Medical Health and Benefits
10354 9 SQUARE Bank and Service Charges Winter Theatre
10368 8 NCR PAYMENT SOLUTIONS,PA, LLC Bank and Service Charges Liquor Store Delivery
308655 5 CEF EP COMMUNITY SOLAR LLC Electric Facilities Operating ISF
308657 4 COMCAST Other Contracted Services Police Sworn4,709,119 Grand Total